KEGG   Sarcophilus harrisii (Tasmanian devil): 100916388
Entry
100916388         CDS       T02286                                 

Gene name
NTRK1
Definition
(RefSeq) high affinity nerve growth factor receptor
  KO
K03176  neurotrophic tyrosine kinase receptor type 1 [EC:2.7.10.1]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr04010  MAPK signaling pathway
shr04014  Ras signaling pathway
shr04020  Calcium signaling pathway
shr04151  PI3K-Akt signaling pathway
shr04210  Apoptosis
shr04722  Neurotrophin signaling pathway
shr04750  Inflammatory mediator regulation of TRP channels
shr05200  Pathways in cancer
shr05202  Transcriptional misregulation in cancer
shr05216  Thyroid cancer
shr05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:shr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100916388 (NTRK1)
   04014 Ras signaling pathway
    100916388 (NTRK1)
   04020 Calcium signaling pathway
    100916388 (NTRK1)
   04151 PI3K-Akt signaling pathway
    100916388 (NTRK1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100916388 (NTRK1)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100916388 (NTRK1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100916388 (NTRK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100916388 (NTRK1)
   05202 Transcriptional misregulation in cancer
    100916388 (NTRK1)
   05230 Central carbon metabolism in cancer
    100916388 (NTRK1)
  09162 Cancer: specific types
   05216 Thyroid cancer
    100916388 (NTRK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:shr01001]
    100916388 (NTRK1)
Enzymes [BR:shr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100916388 (NTRK1)
Protein kinases [BR:shr01001]
 Receptor tyrosine kinases (RTK)
  TRK family [OT]
   100916388 (NTRK1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase LRR_8 Ig_3 Ig_2 TrkA_TMD I-set TPKR_C2 ig C2-set_2
Other DBs
NCBI-GeneID: 100916388
NCBI-ProteinID: XP_031822658
Ensembl: ENSSHAG00000016453
LinkDB
Position
4
AA seq 795 aa
MLRAGRSGQLGRQGCPWALLAWLLLVPSGIAHCPHACCPFGPSGLLCVKPGALSSFGLLT
SLENLTSLENLTELHIENQKDLKHLALSDLSFLRELRNLTIVHSGLQSVAPDAFHFTPRL
SRLNLSSNALNSLSWKTVQGLPLQELILTGNPLNCSCALQWLQRWEDKGLAKLGFPCQEP
AAIMPNDSCGKPLLKIELSSATVNVGDNVTLNCQMESQGRSWAGWNIEELSEFATVVPLE
SGNLSSLWLILVNVSSDLNRKNVTCWAENDVGRSEESVQINVSFPAKVHLHQAIAQHHWC
IPFSVDGQPPPTITWRFNGHVLNETNFIFTEFLEQAANETMQHGCLRLNKPTHVNNGNYT
LEASNPGGRDVASRFFIFMDNPFQFKPEDPIPVSYSPGATNSTSGHPVEKKEDSYFGVSV
AVGLAVFACLFLLVLLILLNKCGRRSKFGINRPAVLAPEDSLAMSLHFMTLGNSSLSPEG
KGSGLQGHIIENPQYFSDACVHHIKRRDIVLKWELGEGAFGKVFLAECHNLLPEQDKMLV
AVKALKEVSESARQDFQREAELLTVLQHQHIVRFFGVCTEGRPLLMVFEYMKHGDLNRFL
RSHGPDAKILASGVGTAPGPLGLGQLLAVAGQVAAGMVYLASLHFVHRDLATRNCLVGQG
LVVKIGDFGMSRDIYSTDYYRVGGRTMLPIRWMPPESILYRKFTTESDVWSFGVLLWEIF
TYGKQPWYQLSNTEAIECITQGRELERPRACPPEVYAIMRGCWQREPQQRHSIKDIHARL
QALIKAPPVYLDVLG
NT seq 2388 nt   +upstreamnt  +downstreamnt
atgctcagagccgggaggagcgggcagcttggcaggcagggctgcccctgggccctgcta
gcctggctgcttctggtgccctcgggcattgcccactgcccccatgcctgctgccccttt
ggcccctcagggctgctctgcgtaaagccaggagctctctccagctttggcctcctgaca
agcttggagaacctgacaagcttggagaacctgacggagctccatattgagaaccagaag
gacttgaagcatctggccctgtctgacctgagcttcctgagagagctgaggaacctcacc
attgtacacagtggtctccaatcggtggctccagatgcctttcacttcacccctcggctg
agcagattgaatctttcttccaatgcactgaactcactttcttggaaaactgttcagggc
cttcccctgcaggaactgattctgactggaaaccccctgaactgttcctgtgctcttcaa
tggctgcagcgctgggaggacaaagggctggccaaactggggtttccatgccaggagccg
gctgccatcatgcccaatgacagctgtggaaagcccctgctgaagattgagctgtccagt
gctacagtgaatgtaggggacaacgtgacactgaattgccagatggagagccagggacgg
agctgggctggctggaacattgaagagctatctgagtttgccactgtggtgcccctggaa
tctgggaatctgtcttccttatggttgattctggtcaatgtctccagcgacctcaacagg
aagaatgtgacatgctgggctgagaatgatgtgggcaggtcggaggaatctgtgcagatc
aacgtctccttcccagctaaggtgcatctccatcaagcaattgcccagcaccactggtgc
atccctttctccgtggacgggcagccaccgcccaccatcacctggcgcttcaacggccac
gtgctcaatgagaccaacttcatcttcacggagttcctggagcaggcagccaacgagacc
atgcagcacggctgcctgcgacttaacaagcccacgcacgtcaacaacggcaattatacc
ctggaagcctccaaccctggtggccgggacgttgcttctcggttttttatcttcatggac
aatcctttccagttcaaacccgaggatcccatccctgtttcttattccccgggagcaacc
aacagcacttctgggcaccccgtggagaagaaggaagactcatattttggggtctcagtg
gcagtgggcttagctgtttttgcctgcctctttctcttggttttactcattcttctcaac
aaatgtggccggagaagcaagttcggaatcaaccgtcctgcggtcctggcccccgaggac
agtctggccatgtccctacatttcatgactctgggaaacagttccctatctcctgaggga
aagggatccggcctgcaggggcacatcatcgagaatccacaatacttcagtgacgcctgt
gtccatcacattaagcgcagagacatcgtgctcaaatgggagctgggagaaggtgccttc
gggaaggtcttcctggccgaatgtcacaacctgcttccagagcaggacaagatgctcgtg
gctgtcaaggctctgaaggaggtgtccgagagtgcccgtcaggacttccagcgggaggca
gagctgctgaccgtcctgcagcaccaacacatagtccgctttttcggggtctgcacagag
ggccgcccactgctcatggtcttcgagtacatgaaacacggagacctgaaccgctttctc
aggtctcatgggccagatgctaagatactggctagcggagtgggtacggctcctggaccc
ctaggcctggggcagctgctggcagtggccggccaggtggcagctgggatggtctacctg
gctagcctgcattttgtgcaccgtgacctggccaccaggaactgcctggtgggtcagggg
cttgtggtcaagattggagactttggtatgagccgagacatctacagcactgactactac
cgggtggggggccgcacgatgctacctatacgatggatgccgccagagagtatcctctat
cggaagttcaccacggaaagtgatgtctggagcttcggcgtccttctctgggagatcttc
acctatggcaaacagccctggtaccagctctccaacactgaggccatcgagtgcattact
cagggcagggaactggagaggccccgggcctgtcccccagaggtctacgccatcatgcgt
ggctgctggcagcgggagccccagcaacgccacagcatcaaggacatccatgcccggctc
caggccctcatcaaggcccctcccgtctacctggacgtcctgggctag

DBGET integrated database retrieval system