KEGG   Sarcophilus harrisii (Tasmanian devil): 100916396Help
Entry
100916396         CDS       T02286                                 

Gene name
NEU2
Definition
(RefSeq) sialidase-2
  KO
K12357  sialidase-2/3/4 [EC:3.2.1.18]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr00511  Other glycan degradation
shr00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:shr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    100916396 (NEU2)
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    100916396 (NEU2)
Enzymes [BR:shr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     100916396 (NEU2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BNR_2 BNR
Motif
Other DBs
NCBI-GeneID: 100916396
NCBI-ProteinID: XP_003770205
Ensembl: ENSSHAG00000007546
UniProt: G3VZV5
LinkDB All DBs
Position
4
AA seq 374 aa AA seqDB search
MVSFLVGQKDKLFQSRAQTYRIPALIYLAQHHTLLAFAEQRAGKADEKAKKIILRRGQYQ
AEAHQVQWQEMEVMETAQLEGHRSMSPCPVYDEDTGTLFLLFITVPNEISESYQIQNKTN
LVRVCYVTSRDLGSTWSPATDFTSSAIGPIYTQWATFCIGPGHGVQLHNQSRSLVVPAYA
YRLLESQKPTSHAFCLRSDDHGETWKMGHFVSMGNTFESQVAEVSAHGQKVLYCNSRSTL
GRRVQAVSPNDGDDFQDAGQIEKLIEPPYGCHGSVIGFPNPTPNVPGSADTWVLYSHPTD
PLRRRNLGLYINRDPLDPAGWSKPVILSNGFCAYSDLQYMGLSPNGSPRFGCLFEHGDYE
EIFFVTLTLQDPFY
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atggtttcattcctagtgggccagaaggacaagctcttccagagcagagcccagacctac
aggatcccagccctgatctacctggcccagcaccacactctgttggcgttcgctgagcag
agggctggcaaggccgacgagaaggccaagaaaatcatcctgcgcagagggcagtatcag
gcggaggcccaccaggtgcagtggcaagagatggaagtgatggagacagctcagttggaa
ggtcaccgctccatgagcccctgcccggtgtatgacgaggacacggggaccctgtttctg
ctgttcataaccgtcccaaatgaaatctcagaatcctaccagatccaaaacaagaccaac
ctggtgcgcgtgtgctacgtgaccagccgggacttggggagcacctggagcccagccaca
gacttcacctcttctgccatcgggcccatctacacgcagtgggccacattttgcattggg
ccgggccacggggtgcaactccacaaccagtcccggagcctggtggtccccgcctatgct
tatcggcttctcgagtcccagaagcccacctcccatgccttctgcctccgcagtgacgat
cacggggagacatggaagatgggacactttgtgagcatgggaaacacctttgaatcccaa
gtggccgaagtctccgctcacggacagaaggtcctgtactgtaactccagaagcaccctc
gggaggagggtccaggcggtcagtcccaatgatggggacgacttccaggatgctggacag
atcgagaaactgatcgaaccaccatatggctgccatggaagtgtgatcggcttccctaat
cccaccccaaatgtcccgggctctgcggacacctgggtgctttactcccatcccacagat
cctctgaggcggagaaatttgggcttgtatattaacagggatcccttggacccagcaggt
tggagcaagccggtcatcctctcaaatggcttctgtgcttactcggacctccagtacatg
gggctaagccccaatgggtcaccccggtttggctgcttatttgaacatggagattatgag
gaaatcttctttgtcacgctcaccctccaggaccccttctattag

DBGET integrated database retrieval system