KEGG   Sarcophilus harrisii (Tasmanian devil): 100916731
Entry
100916731         CDS       T02286                                 

Gene name
BAK1
Definition
(RefSeq) bcl-2 homologous antagonist/killer isoform X2
  KO
K14021  Bcl-2 homologous antagonist/killer
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr01524  Platinum drug resistance
shr04141  Protein processing in endoplasmic reticulum
shr04210  Apoptosis
shr04215  Apoptosis - multiple species
shr05022  Pathways of neurodegeneration - multiple diseases
shr05132  Salmonella infection
shr05160  Hepatitis C
shr05162  Measles
shr05163  Human cytomegalovirus infection
shr05164  Influenza A
shr05165  Human papillomavirus infection
shr05167  Kaposi sarcoma-associated herpesvirus infection
shr05168  Herpes simplex virus 1 infection
shr05169  Epstein-Barr virus infection
shr05170  Human immunodeficiency virus 1 infection
shr05200  Pathways in cancer
shr05202  Transcriptional misregulation in cancer
shr05203  Viral carcinogenesis
shr05206  MicroRNAs in cancer
shr05210  Colorectal cancer
shr05212  Pancreatic cancer
shr05213  Endometrial cancer
shr05214  Glioma
shr05216  Thyroid cancer
shr05217  Basal cell carcinoma
shr05218  Melanoma
shr05220  Chronic myeloid leukemia
shr05222  Small cell lung cancer
shr05223  Non-small cell lung cancer
shr05224  Breast cancer
shr05225  Hepatocellular carcinoma
shr05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:shr00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100916731 (BAK1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100916731 (BAK1)
   04215 Apoptosis - multiple species
    100916731 (BAK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100916731 (BAK1)
   05202 Transcriptional misregulation in cancer
    100916731 (BAK1)
   05206 MicroRNAs in cancer
    100916731 (BAK1)
   05203 Viral carcinogenesis
    100916731 (BAK1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100916731 (BAK1)
   05212 Pancreatic cancer
    100916731 (BAK1)
   05225 Hepatocellular carcinoma
    100916731 (BAK1)
   05226 Gastric cancer
    100916731 (BAK1)
   05214 Glioma
    100916731 (BAK1)
   05216 Thyroid cancer
    100916731 (BAK1)
   05220 Chronic myeloid leukemia
    100916731 (BAK1)
   05217 Basal cell carcinoma
    100916731 (BAK1)
   05218 Melanoma
    100916731 (BAK1)
   05213 Endometrial cancer
    100916731 (BAK1)
   05224 Breast cancer
    100916731 (BAK1)
   05222 Small cell lung cancer
    100916731 (BAK1)
   05223 Non-small cell lung cancer
    100916731 (BAK1)
  09164 Neurodegenerative disease
   05022 Pathways of neurodegeneration - multiple diseases
    100916731 (BAK1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100916731 (BAK1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100916731 (BAK1)
   05160 Hepatitis C
    100916731 (BAK1)
   05164 Influenza A
    100916731 (BAK1)
   05162 Measles
    100916731 (BAK1)
   05168 Herpes simplex virus 1 infection
    100916731 (BAK1)
   05163 Human cytomegalovirus infection
    100916731 (BAK1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100916731 (BAK1)
   05169 Epstein-Barr virus infection
    100916731 (BAK1)
   05165 Human papillomavirus infection
    100916731 (BAK1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100916731 (BAK1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:shr03029]
    100916731 (BAK1)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:shr02000]
    100916731 (BAK1)
Mitochondrial biogenesis [BR:shr03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    100916731 (BAK1)
Transporters [BR:shr02000]
 Other transporters
  Pores ion channels [TC:1]
   100916731 (BAK1)
SSDB
Motif
Pfam: Bcl-2 Bcl-2_3
Other DBs
NCBI-GeneID: 100916731
NCBI-ProteinID: XP_003769014
Ensembl: ENSSHAG00000005103
LinkDB
Position
4
AA seq 204 aa
MASRQVSRVRAPSSTAEEQVALQTEEVFRSYVFYRHQQEQESEGDAVLADPEMDTLPQEL
SSTTEQVGRQLAIIGDNIIRRYNSEFEAMLQHLQPTPETAYESFVKIASSLFESGINWGR
VVALLGFGYRLALYVYRRGLTGFLGHVARFVADFMLQHFVTRWIAQNGGWVAALDLSNNS
IWYVMTILGMVLLGRFIIRRFFQP
NT seq 615 nt   +upstreamnt  +downstreamnt
atggcttctaggcaggtgagccgggttcgagccccttcatctactgcagaggaacaggtg
gctctacagactgaagaggttttccgaagctatgtcttctatcgccatcaacaagagcag
gaaagtgagggagatgctgtccttgcagacccagaaatggacaccctgccacaagagctc
agcagcaccacagaacaggtgggccgacagctggccatcattggggataacatcattcgc
aggtataactcagaatttgaggccatgctgcagcatttgcagcccaccccggaaactgcc
tatgagagcttcgtcaagatcgcctccagcctatttgaaagcggcatcaactggggccga
gtggtggcactgctgggctttggctaccggctggcactatatgtttatcggaggggtctg
actggcttcctgggccatgtggctcgcttcgtggctgacttcatgctccaacactttgtc
acccgctggattgcccagaacgggggctgggtggcagccctggacctctccaacaactcc
atttggtacgtgatgacaatcttggggatggtgctcttgggtcgattcattatccgaaga
ttctttcaaccctga

DBGET integrated database retrieval system