KEGG   Sarcophilus harrisii (Tasmanian devil): 100916994
Entry
100916994         CDS       T02286                                 

Gene name
TPM3
Definition
(RefSeq) tropomyosin alpha-3 chain isoform X1
  KO
K09290  tropomyosin 3
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr04260  Cardiac muscle contraction
shr04261  Adrenergic signaling in cardiomyocytes
shr05200  Pathways in cancer
shr05216  Thyroid cancer
shr05410  Hypertrophic cardiomyopathy
shr05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:shr00001]
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    100916994 (TPM3)
   04261 Adrenergic signaling in cardiomyocytes
    100916994 (TPM3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100916994 (TPM3)
  09162 Cancer: specific types
   05216 Thyroid cancer
    100916994 (TPM3)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100916994 (TPM3)
   05414 Dilated cardiomyopathy
    100916994 (TPM3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:shr04812]
    100916994 (TPM3)
Cytoskeleton proteins [BR:shr04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Tropomyosins
     100916994 (TPM3)
SSDB
Motif
Pfam: Tropomyosin Tropomyosin_1 Laminin_II CLZ TMF_DNA_bd HrpB7 ATG16 ERM MAD CENP-F_leu_zip DUF745 ADIP BORCS7 Laminin_I
Other DBs
NCBI-GeneID: 100916994
NCBI-ProteinID: XP_031822483
Ensembl: ENSSHAG00000012786
LinkDB
Position
4
AA seq 285 aa
MMEAIKKKMQMLKLDKENALDRAEQAEAEQKQAEDRSKQLEDELAAMQKKLKGTEDELDK
YSEALKDAQEKLELAEKKAADAEAEVASLNRRIQLVEEELDRAQERLATALQKLEEAEKA
ADESERGMKVIENRALKDEEKMELQEIQLKEAKHIAEEADRKYEEVARKLVIIEGDLERT
EERAELAESRCREMDEQIRLMDQNLKCLNAAEEKYSQKEDKYEEEIKILTDKLKEAETRA
EFAERSVAKLEKTIDDLEDKLKCTKEEHLCTQRMLDQTLLDLNEM
NT seq 858 nt   +upstreamnt  +downstreamnt
atgatggaggccatcaagaaaaagatgcaaatgctgaaactggacaaggaaaatgccttg
gaccgggcagagcaggctgaggctgaacagaagcaggcagaggaccgaagcaagcagttg
gaggatgagctggctgctatgcagaagaagttgaagggaacggaggatgaactggacaag
tattcagaagcactgaaggatgcccaggagaagctggaactggcagagaagaaggcagca
gatgctgaggctgaggtggcttccttgaaccgtcggatccagttggtagaagaggagctg
gaccgtgctcaggagcgcctggctacagctctgcagaagttagaggaggcagagaaggca
gctgatgagagtgagagaggtatgaaggtcattgaaaatcgggccttgaaggatgaagaa
aagatggagctgcaagaaatccagctgaaagaggctaagcacattgctgaagaagcagac
aggaagtacgaggaggtggcccgaaagttggtaatcattgagggagacttggagcgcaca
gaggagcgggccgagctggcagaatcccgttgccgggagatggatgagcagatcagactg
atggaccagaacctgaagtgtctgaatgctgctgaagaaaagtattctcagaaagaagac
aaatatgaggaggagataaaaattcttaccgataaactcaaggaggcagagactcgtgct
gagtttgctgagagatcagtagccaagctggaaaagacaattgatgacttggaagataaa
ctgaaatgcaccaaagaggagcacctctgcacacaaaggatgctggaccagactctgctt
gacctgaatgagatgtag

DBGET integrated database retrieval system