KEGG   Sarcophilus harrisii (Tasmanian devil): 100917007
Entry
100917007         CDS       T02286                                 

Gene name
MET
Definition
(RefSeq) hepatocyte growth factor receptor
  KO
K05099  proto-oncogene tyrosine-protein kinase Met [EC:2.7.10.1]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr01521  EGFR tyrosine kinase inhibitor resistance
shr04010  MAPK signaling pathway
shr04014  Ras signaling pathway
shr04015  Rap1 signaling pathway
shr04020  Calcium signaling pathway
shr04151  PI3K-Akt signaling pathway
shr04360  Axon guidance
shr04510  Focal adhesion
shr04520  Adherens junction
shr05100  Bacterial invasion of epithelial cells
shr05144  Malaria
shr05200  Pathways in cancer
shr05202  Transcriptional misregulation in cancer
shr05205  Proteoglycans in cancer
shr05206  MicroRNAs in cancer
shr05211  Renal cell carcinoma
shr05218  Melanoma
shr05223  Non-small cell lung cancer
shr05225  Hepatocellular carcinoma
shr05226  Gastric cancer
shr05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:shr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100917007 (MET)
   04014 Ras signaling pathway
    100917007 (MET)
   04015 Rap1 signaling pathway
    100917007 (MET)
   04020 Calcium signaling pathway
    100917007 (MET)
   04151 PI3K-Akt signaling pathway
    100917007 (MET)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100917007 (MET)
   04520 Adherens junction
    100917007 (MET)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    100917007 (MET)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100917007 (MET)
   05202 Transcriptional misregulation in cancer
    100917007 (MET)
   05206 MicroRNAs in cancer
    100917007 (MET)
   05205 Proteoglycans in cancer
    100917007 (MET)
   05230 Central carbon metabolism in cancer
    100917007 (MET)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100917007 (MET)
   05226 Gastric cancer
    100917007 (MET)
   05218 Melanoma
    100917007 (MET)
   05211 Renal cell carcinoma
    100917007 (MET)
   05223 Non-small cell lung cancer
    100917007 (MET)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    100917007 (MET)
  09174 Infectious disease: parasitic
   05144 Malaria
    100917007 (MET)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100917007 (MET)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:shr01001]
    100917007 (MET)
Enzymes [BR:shr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100917007 (MET)
Protein kinases [BR:shr01001]
 Receptor tyrosine kinases (RTK)
  MET family
   100917007 (MET)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Sema Pkinase TIG PSI Pkinase_fungal Kinase-like LapA_dom
Other DBs
NCBI-GeneID: 100917007
NCBI-ProteinID: XP_003771590
Ensembl: ENSSHAG00000015881
UniProt: G3WTF3
LinkDB
Position
5
AA seq 1379 aa
MKPPAVLVPGITMLLLALVPNCKAECKEALVKSEMDVNRKYPLPNFIAETPIQNIVFHNH
HIFLGAINKIYVLNEDLHNVSEYKTGPVLEHPDCSPCQDCSHKANLSGSVWKDNVNKALL
IDTYYDDQLISCGSVNRGTCQRHVFQPNNAADIQSQVYCIYSPQMDEESLQCPDCVVSTL
GTKVLLTEKDRFINFFVGNTINSSYADHSSHSISVRRLKETQDGFKFLTDQSYIDVLPEF
QDSYPIKYIHAFESSDFIYFLTVQRETLESQTFHTRIIRFCSIDSGLHSYMEMPLECILT
EKRRKRSPREEVFNVLQAAYVSKPGAHLARQIGVGPNDDIIFGVFAQSKPDSSEPIKRSA
VCAFPIKFVNDFFNRIVNKNNVRCLQHFYGNNHKHCFNRTFLRNSSGCEARDDEYRTEFT
TGLQRIDLFTGQFKQVLLTSISTFIKEDLTIANLGTSDGRFMQVVVSRGQSTPHVNFQLD
SHPVSPEVIVEHPLNADGFTLVITGKKITKIPLNGLGCDHFKSCSQCLSAPPFVQCTWCH
NQCVKSKECVTELGNQDICLPTIYEILPTSAPLEGGTTLTVCGWDFGLRKNNKFDFRKTK
VFIGNESCILNTSESTTNKLKCTVGPAVNLHFNVSIIISNGRETTKFNSFSYVDPVITNI
SPSYGPKAGGTVLTLIGKYLNSGNSRRISIGGKPCILKSVSHSLLECYTPAQTIPSEYPI
KMKIDLANREAYSFTYKEDPIVHKIHPTKSFLSGGSTITGFGKNLNSASVPKMVINVPEV
GRNFTVACKHRSNSEIICCSTPSLQQLNLQPPLETKALFIFDGIHSTYFDLIYVHNPVFK
PFEKPVMISMGNENVLEIKGNDIDPEAVKGEVLKVGNKSCENIRLNSETVLCTVPSDLLK
LNSELNIEWKQAVSSTVLGKVIVQPDQNFTGLIVGVVLISLLLLFLLGLFLWLKKRKQIK
DLGSDLVRYDARVHTPHLDRLVSARSVSPTTEMVSNESVDYRATFPEDQFPHSSQNGSCR
QAHYPLTDLSPILTSADSDISSPLLQNHVHIDISALNPDLVQAVQHVVIGPNSLIVHFNE
IIGRGHFGCVYHGTLLDNDGKKIHCAVKSLNRITDIGEVSQFLTEGIIMKDFSHPNVLSL
LGICLRSEGSPLVVLPYMKHGDLRNFIRNETHNPTVKDLIGFGLQVAKGMKYLASKKFVH
RDLAARNCMLDEKFTVKVADFGLARDMYDKEYYSVHNKTGAKLPVKWMALESLQTQKFTT
KSDVWSFGVLLWELMTRGAPPYPDVNTFDITVYLLQGRRLLQPEYCPDPLYEVMLKCWHP
KAEMRPSFSELVSKISVIFSTFIGEHYVHVNATYVNVKCVAPYPSLLSSQDNVDREVDT
NT seq 4140 nt   +upstreamnt  +downstreamnt
atgaagccccctgctgtgcttgtacctgggattacaatgttactgcttgccttggtgccg
aattgcaaagcagagtgtaaggaagccctagtcaagtctgaaatggatgttaataggaag
tatccacttcccaacttcattgcagaaaccccgatccaaaacatcgtttttcacaatcac
cacatctttctgggtgcaatcaacaagatttatgtcttaaatgaagatcttcataatgtt
tctgagtataagacgggacctgtgctggaacaccctgattgttctccgtgtcaggattgc
agtcacaaagccaacttatcaggtagtgtttggaaggataatgtcaataaagccttgctt
attgatacctactatgatgaccagctcattagttgtggcagtgtcaatcgagggacctgc
cagcgccatgtgtttcagcccaataatgctgctgatatacagtcacaagtttattgcata
tattccccacagatggatgaggagtccctccaatgtcctgactgtgtggtaagcacttta
gggaccaaagttctactgacagaaaaagaccgatttataaacttctttgtaggcaatacc
ataaattcttcttacgctgatcattcctcgcattcaatatctgttaggaggctaaaggaa
acacaagatggttttaaatttttgactgatcaatcctatattgatgttctacctgaattc
caagattcttaccctattaaatatatacatgcctttgaaagcagtgacttcatttatttt
ctgactgtacaaagagaaactctcgaatctcagacttttcacacacgaataatcaggttc
tgttccattgactctggattgcattcatacatggaaatgcctcttgaatgtattcttact
gagaagaggagaaagaggtcgccaagggaagaagtatttaatgttctacaagctgcatat
gtgagtaagcctggtgcacatctagctaggcaaataggcgttggacccaatgatgacatt
atctttggagtatttgcacaaagtaaaccagactcttcagaaccaatcaagagatcagca
gtctgcgcattcccaatcaaatttgtcaatgatttcttcaacagaattgtgaacaaaaat
aatgtgagatgtcttcagcacttttatgggaacaatcacaagcactgctttaataggaca
tttttaagaaactcatcaggttgtgaagcaagagatgatgaatataggacagaatttact
acaggcttgcaacgtatcgatttattcactggacaattcaagcaagttcttttaacatca
atatctacttttatcaaggaagacctaaccattgcaaaccttggaacatcagatggtcga
tttatgcaggttgtggtttctcggggacaatcaacccctcatgtgaattttcaattggat
tcccatcccgtttccccagaagtgattgttgagcatccactaaatgcagatggcttcaca
ctagttattactgggaaaaagataactaagatcccattgaatggcctaggttgtgaccat
tttaagtcctgcagccaatgtctctcagctcctccttttgtgcaatgtacctggtgtcat
aatcaatgtgtgaaatctaaagaatgtgtcactgaactagggaaccaagatatttgtctg
cctactatttatgagattctcccaactagtgcacccctagagggaggcacaacactgact
gtgtgtggctgggattttggattaagaaaaaataataaatttgattttagaaaaaccaaa
gttttcattggaaatgagagttgcatattgaatacaagtgagagcactacaaataagttg
aaatgtactgttggtcctgctgtgaacctgcatttcaatgtatccatcattatttcaaat
ggtcgagaaacaacaaaatttaattccttctcttatgtggatcctgtaataacaaatatt
tctccaagctatggtcccaaggctggtggtacagtacttactttaattgggaaatatcta
aacagtggaaattctagacgtatttcaatcggtggaaagccatgtattttaaaaagtgtg
tctcatagccttctagaatgttatactcctgcacaaaccattccaagtgagtaccccatt
aaaatgaaaattgacttagccaatcgagaagcctacagttttacatacaaagaggaccct
attgttcataaaatccatccaaccaaatcttttcttagtggaggaagcacaataacaggt
tttggaaaaaacctgaattctgctagcgtgcccaagatggtaataaatgtccctgaagta
ggaaggaacttcacagtggcatgtaagcatcgatctaattcagagataatctgttgttcg
actccttccttacaacagctaaatctgcaaccccccctggaaacaaaagctcttttcata
tttgatggtatccattccacttactttgatctcatttatgtccataatcctgtatttaag
ccttttgaaaagccagtgatgatctcaatgggcaatgaaaatgtactagaaattaaggga
aatgatattgaccctgaggcagtaaaaggtgaagtgttaaaagtgggaaataaaagctgt
gagaatatccgcttgaactctgaaacagtcttatgtacagtccccagtgacctgctgaaa
ctgaacagtgagctaaatatagagtggaagcaagcagtttcttctactgtccttggaaaa
gtgatagtacaaccagatcaaaatttcacaggactcattgttggagtggtcttgatatca
ttgttgctcttgtttttactgggcctttttctgtggctgaaaaagaggaagcagattaaa
gatctgggcagtgacttagttcgctatgatgcaagagtacacactcctcacttggacagg
cttgtaagtgcccgaagtgtgagccctaccacagaaatggtttcaaatgaatctgtagac
tacagagcaacttttccagaagatcagtttccacattcttctcagaatggatcctgcaga
caagctcattatcctctgacagatttgtcccccatcctaaccagtgcagattcagatata
tccagtccgctgcttcagaatcatgtccacattgatatcagcgccttaaatccagacctg
gtccaagctgttcaacatgtggttattgggccaaacagcctgattgtgcatttcaatgaa
atcataggaagagggcattttggatgtgtgtatcatgggaccttattggataatgatggc
aagaagattcattgtgctgtgaagtccttgaatagaattactgacataggagaggtttcc
caatttctgactgaagggatcatcatgaaagattttagtcatcccaatgtcctctcactt
ttgggaatctgccttcgtagtgaagggtccccattggtggtcctgccatatatgaaacat
ggagatcttcgaaacttcataagaaatgagactcataacccaacagtgaaagatcttatt
ggctttggtcttcaagtagcgaaaggcatgaaataccttgcaagcaaaaagtttgtccac
agagacttggctgcaagaaattgtatgctggatgaaaaattcactgtcaaggttgctgat
tttgggcttgccagagatatgtatgataaagaatattacagtgtacacaataaaacagga
gcaaaactgccagtgaagtggatggctttagaaagcttgcaaactcagaagtttactaca
aagtcagatgtgtggtcttttggagtgcttctctgggaactaatgactagaggagcacct
ccttatcctgatgttaatacctttgatataacagtttatttattgcaaggtcgaaggctt
ttgcaacctgaatactgcccagatccactgtatgaagttatgctaaaatgctggcaccca
aaagctgaaatgcgtccctctttctctgaactggtctcaaagatatcagtcatattctct
acatttattggagagcattatgttcacgtgaatgcaacctacgtcaatgtaaaatgtgtt
gctccttacccttcccttttgtcatcccaagacaacgttgacagggaggtggacacctga

DBGET integrated database retrieval system