KEGG   Sarcophilus harrisii (Tasmanian devil): 100917052
Entry
100917052         CDS       T02286                                 

Gene name
RASSF1
Definition
(RefSeq) ras association domain-containing protein 1 isoform X2
  KO
K09850  Ras association domain-containing protein 1
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr04014  Ras signaling pathway
shr04390  Hippo signaling pathway
shr04392  Hippo signaling pathway - multiple species
shr05200  Pathways in cancer
shr05206  MicroRNAs in cancer
shr05219  Bladder cancer
shr05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:shr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100917052 (RASSF1)
   04390 Hippo signaling pathway
    100917052 (RASSF1)
   04392 Hippo signaling pathway - multiple species
    100917052 (RASSF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100917052 (RASSF1)
   05206 MicroRNAs in cancer
    100917052 (RASSF1)
  09162 Cancer: specific types
   05219 Bladder cancer
    100917052 (RASSF1)
   05223 Non-small cell lung cancer
    100917052 (RASSF1)
SSDB
Motif
Pfam: Nore1-SARAH RA C1_1
Other DBs
NCBI-GeneID: 100917052
NCBI-ProteinID: XP_003762359
LinkDB
Position
1
AA seq 367 aa
MAAEPELIELKNLVRYPDGLRGQETGRSPGPRSPGRLERANALRITPGRGPDVLPRGRQV
RLLGGHSDPRLTAGPGRGHCFRPSGPGTHTWCDLCGDFIWGVIRKGLQCVHCKFTCHYRC
RALIRLDCFGPRELSLEPTLERDTNVDEPLEWEKPVLSQTEIEQKIKEYNSQINSNLFMS
LNKDGSYTGFIKVQLKLVRPVSVPATKKPPTLQDAKRTTGKNQAVKRRTSFYLPKDTVKH
LHVLSRTRAREVIEALLRKFLVVDNPRKFALFERAERHDQVYLRKLSDDEQPLRLRLLAG
PSEKALSFVLKENETGDVNWDAFSMPELHNFLRILQREEEEHVRQILQKYSRCRQKMQEA
LGARPLG
NT seq 1104 nt   +upstreamnt  +downstreamnt
atggctgcagagccggagctgattgagttaaagaacttggtccgctaccccgacgggctg
cgggggcaggagactggccggagtccgggccctcggagtccaggccggctggagcgcgcc
aatgcgctgcgcatcaccccgggccgcggccctgacgtgctgccccgcggccgtcaagtc
cggctgctgggaggccacagcgatccccgactcaccgcgggacccggccggggccactgc
ttccgcccatcgggacccggcacccacacttggtgcgacctctgtggggacttcatctgg
ggcgtcattcgcaagggcctgcaatgcgtccattgcaagtttacttgccattatcgatgc
cgggccctgatccgtttagactgttttggtccccgagaactgagcttggagcctaccttg
gaaagagacaccaatgtggatgagccactggagtgggagaaaccagtcctgtctcaaact
gagattgagcagaagatcaaggagtacaatagccagatcaacagtaacctcttcatgagc
ctgaacaaggacggctcctatactggtttcatcaaagtacagttgaaacttgtgcgtccg
gtgtctgtgcccgctaccaagaagccccctaccctgcaggatgccaaacgaaccactggg
aagaatcaggccgtgaagcgtcgtacctccttttacctccccaaagacacagtcaaacac
ctgcatgtgttgtcacgaacacgggcccgagaggtcattgaggcgctgctccgaaagttc
ctggtggtggataacccccggaaatttgccttatttgagcgggcagaacgtcatgaccaa
gtgtacctgcgaaagctgtcggatgacgagcagcccttgcgcttaaggctgcttgcaggg
cccagtgaaaaagctttgagttttgtcctaaaggaaaatgagactggggatgtcaattgg
gatgccttcagcatgcccgagttacataatttccttcggatccttcaacgggaagaagag
gaacacgtgcgacaaatcctccagaagtattctcgttgccgccagaagatgcaggaagca
ctaggagcccgccctttgggatga

DBGET integrated database retrieval system