KEGG   Sarcophilus harrisii (Tasmanian devil): 100917083
Entry
100917083         CDS       T02286                                 

Gene name
FOXO3
Definition
(RefSeq) forkhead box protein O3
  KO
K09408  forkhead box protein O3
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr01521  EGFR tyrosine kinase inhibitor resistance
shr04062  Chemokine signaling pathway
shr04068  FoxO signaling pathway
shr04137  Mitophagy - animal
shr04151  PI3K-Akt signaling pathway
shr04152  AMPK signaling pathway
shr04211  Longevity regulating pathway
shr04213  Longevity regulating pathway - multiple species
shr04218  Cellular senescence
shr04722  Neurotrophin signaling pathway
shr04917  Prolactin signaling pathway
shr05213  Endometrial cancer
shr05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:shr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100917083 (FOXO3)
   04151 PI3K-Akt signaling pathway
    100917083 (FOXO3)
   04152 AMPK signaling pathway
    100917083 (FOXO3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    100917083 (FOXO3)
  09143 Cell growth and death
   04218 Cellular senescence
    100917083 (FOXO3)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    100917083 (FOXO3)
  09152 Endocrine system
   04917 Prolactin signaling pathway
    100917083 (FOXO3)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100917083 (FOXO3)
  09149 Aging
   04211 Longevity regulating pathway
    100917083 (FOXO3)
   04213 Longevity regulating pathway - multiple species
    100917083 (FOXO3)
 09160 Human Diseases
  09162 Cancer: specific types
   05213 Endometrial cancer
    100917083 (FOXO3)
   05223 Non-small cell lung cancer
    100917083 (FOXO3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100917083 (FOXO3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:shr03000]
    100917083 (FOXO3)
Transcription factors [BR:shr03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix other regulators
    100917083 (FOXO3)
SSDB
Motif
Pfam: FOXO_KIX_bdg Forkhead FOXO-TAD
Other DBs
NCBI-GeneID: 100917083
NCBI-ProteinID: XP_023358910
LinkDB
Position
4
AA seq 692 aa
MAEAPSSPAPLSPLEVELDPEFEPQSRPRSCTWPLQRPELQASPAKPSGEAAADSMIPEE
EDDEEDEDGGCGAPGGGGGSGMAMALGGVSGVLGPGLHPEEAARLLAPGGQDSGPGAPPG
AGVLSGGQQAPLQPPQAPLSLPPPPPPPLQPQQPQQQGVSGAAGQPRKCSSRRNAWGNLS
YADLITRAIESSPDKRLTLSQIYDWMVRCVPYFKDKGDSNSSAGWKNSIRHNLSLHSRFK
RVQNEGTGKSSWWMINPDGGKSGKAPRRRAVSMDNSNKYTKSRGRAAKKKASLQASQEAP
EDSPSQAAKWPGSPTSRSSDELDAWTDFRSRTNSNASTISGRLSPILATAELDDVQDDDP
PLSPMLYSSSSSMSPSVSKPCTVELPRLTDMAGTMNLNDGLTDNLMDDLLDNIALPPSQQ
SPSSGLMQRSSSFPYTAKGSGLGSPSGSLNNAVFGPSSLNSLRQSPMQTIQENKPATFSS
MSHYSNQSLQDLLTSDSLSHSDVMMTQSDPLMSQASSAVSAQSSRRSVMLRSDPMMSFAA
QSGQGSLVSPTLLHQQHQSQNPLGGNRALSGAVSGMGLSETNSLGSAKHQQQSPASQSMQ
TLSDSLSGSSLYSASVNLPVMGHEKFPSDLDLDIFNGSLECDMESIIRSELMDADGLDFN
FDSLISAQNVVSLNVGNFTGAKQASSQSWVPG
NT seq 2079 nt   +upstreamnt  +downstreamnt
atggcagaggcgccgtcctccccggccccgctctcgccgctggaagtggagctggacccg
gagttcgagccccagagccggccccgctcctgtacgtggcccctgcagaggcccgagctg
caggcgagcccggccaagccctcgggggaagcggccgccgactccatgatccccgaggag
gaggacgacgaggaagatgaagacggaggctgcggagccccggggggcggcggaggatcc
ggcatggccatggccttgggcggcgtgagcggcgtcctcggcccgggactgcaccccgag
gaggctgcccggctcctggctcctggagggcaggactcgggacccggcgcgccccccggg
gcaggcgtgctgagcggggggcagcaggcgccgctgcaacctccgcaggcgccgctgtcg
ctgcccccgccgccgccgccgccgctgcagccgcagcagccgcagcaacagggggtgagt
ggggccgcggggcagccgaggaaatgctcctcccggaggaatgcgtggggaaatctgtcc
tacgccgacctgatcacccgggccattgagagctccccggacaaacggctcaccctgtcc
cagatctacgactggatggtgcgctgcgtgccctacttcaaggataagggcgacagcaac
agctccgctggctggaagaactccatccgtcacaacttgtccctacacagtcgattcaaa
agggttcaaaatgaagggaccgggaaaagttcttggtggatgatcaatccagacgggggc
aaaagcggaaaggcgccccggcgaagagccgtctccatggacaacagcaacaaatacacc
aagagcagggggcgagccgctaagaaaaaggcttctctgcaggcttcccaggaggccccg
gaggacagcccgtcccaggccgccaagtggcccggcagccccacctcccggagcagcgac
gagctggacgcctggacggacttccgatcgcgcaccaactccaacgccagcaccatcagc
ggccgcctgtcgccgatcctggccacggccgagctggacgacgttcaggacgacgacccg
ccgctctcccccatgctgtacagcagctcgtcgagcatgtccccgtcggtcagcaagccg
tgcaccgtggagcttccgcggctgacggacatggcgggcaccatgaacctgaacgacggg
ctgacggacaacctcatggacgacctgctggacaatatcgcgctcccgccctcgcagcag
tcgccgtcctcggggctcatgcagaggagctccagcttcccgtacacggccaagggctcg
ggcctgggctccccctcgggcagcctgaacaacgccgttttcggcccctcctctctgaac
tccctgcgccagtcccccatgcagaccatccaggagaacaagcccgccaccttctcttcc
atgtcgcactacagcaaccagtcgctgcaggacctgctgacgtcggactcgctgagccac
agcgatgtcatgatgacgcagtcggacccactgatgtcgcaggccagcagcgccgtgtcg
gcgcagagctcgcggcgcagcgtcatgctccgcagcgacccgatgatgtccttcgccgcc
cagtccggccagggaagcctggtcagcccgaccctcctccaccagcagcaccaatcccag
aatcctctcgggggcaaccgtgccttgtccggcgccgtcagcggcatgggcctgagcgag
accaacagcctgggctcggccaagcaccagcagcagtcgcccgccagccagtctatgcaa
accctctccgactccctctcagggtcctccttgtattccgcgagcgtgaacctcccggtc
atgggccacgaaaagttccccagcgacctggacctggacatttttaacggcagcttggag
tgtgacatggagtccatcattcgcagcgaactcatggacgccgatgggctggactttaac
tttgattccctcatctccgctcagaacgttgtcagtctgaatgtggggaacttcactggt
gctaagcaggcctcatctcagagttgggtgccgggctga

DBGET integrated database retrieval system