KEGG   Sarcophilus harrisii (Tasmanian devil): 100917328
Entry
100917328         CDS       T02286                                 

Gene name
COL4A3
Definition
(RefSeq) collagen alpha-3(IV) chain
  KO
K06237  collagen type IV alpha
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr04151  PI3K-Akt signaling pathway
shr04510  Focal adhesion
shr04512  ECM-receptor interaction
shr04926  Relaxin signaling pathway
shr04933  AGE-RAGE signaling pathway in diabetic complications
shr04974  Protein digestion and absorption
shr05146  Amoebiasis
shr05165  Human papillomavirus infection
shr05200  Pathways in cancer
shr05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:shr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100917328 (COL4A3)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100917328 (COL4A3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100917328 (COL4A3)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    100917328 (COL4A3)
  09154 Digestive system
   04974 Protein digestion and absorption
    100917328 (COL4A3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100917328 (COL4A3)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100917328 (COL4A3)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100917328 (COL4A3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100917328 (COL4A3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100917328 (COL4A3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:shr04147]
    100917328 (COL4A3)
   00536 Glycosaminoglycan binding proteins [BR:shr00536]
    100917328 (COL4A3)
Exosome [BR:shr04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   100917328 (COL4A3)
Glycosaminoglycan binding proteins [BR:shr00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   100917328 (COL4A3)
SSDB
Motif
Pfam: Collagen C4
Other DBs
NCBI-GeneID: 100917328
NCBI-ProteinID: XP_031813804
Ensembl: ENSSHAG00000012337
LinkDB
Position
3
AA seq 1674 aa
MSPGGASGRVLPMLLLTRLLLLLLLVVAPAMGKGCVCSDKGPCFCDSRKGDKGEKGFPGC
PGTPGQKGLPGPEGIPGPQGPKGSPGLPGFIGSKGTRGMTGLPGFPGPPGLPGTPGNTGP
YGPPGLPGCNGTKGDQGFPGPPGTPGLPGLPGTNGLKGEKGAPAREEGIENGERGDPGLP
GIPGRQGLPGPPGFPGPPGPQGPPGFLGFPGEMGPPGPKGHMGVKGIGEKGDRGMKGLTG
PPGPPGTVIITLTGPENLTDYKGDKGDKGSVGEPGPPGPKGLPGESYGSEKGVPGDPGPR
GKPGKDGAPGFPGFPGAKGEKGFPGLTGETGAKGFKGDPGPGGFRGPTEYYNGYLEKGND
GIPGAPGPKGDRGSHGPRGPPGDVGRPGASRPGLRGTPGSPGIKGSKGERGPPGVNIMGP
PGLPGLPGTPGSKGLPGLPGPPGKVTFQNGPPGDHGDPGHLGSPGIPGAYGPKGEPGPLC
TQCIYTPGPPGLPGLPGLDGEKGTEGGQGPDGLKGSPGSPGYTGLPGFPGFPGTPGYQGQ
KGEKGETSYEGEVGDRGDPGVRGEPGKRGSDGIPGKPGTKGLPGTKGEPAVNGEKGDKGF
PGNPGDPGYPGPMGPAGPSNYGPPGQPGPKGAAGVPGFPGSPGNDGPKGEPGLVEPVPGP
PGPPGLPGLPGLPGTTGNPGSKGPSGNPGPPGSDGEAGFPGIGVPGPPGYKGDRGDPGAK
GSPGCPGEIGNPGSPGLPGLPGAKGDPGTAMPGKEGITGFQGEKGNLGENGENGIPGLPG
LPGPPGNKGHDGSPGEPGFPGPPGYDGIPGICIPGAKGTQGLPGLNGLKGPQGDRGLEGP
KGDPGIPGLDRSGSPGEPGPPGLPGHQGDKGLRGPAGYPGAPGPPGPPGQKGEVGIMGYP
GTIGPPGIPGNPGTPGHKGNLGIPGRKGQKGLPGVQGERGNKGNEGPSMISDDVGEKGEP
GPEGSLGGLGQKGERGTPGVPGSQGYDGMPGRPGLPGLRGDPGTMGHPGEPGPPGGPGSM
GYMGMPGPKGKKGTVGHTGETGRPGLPGIQGMKGEKGEPGYIRDARPGPPGPKGEPGPPG
SLGKKGGRGLPGLPGPIGPSGAEGNQGSSGNRGPPGNPGPAGDLGFKGCKGFPGPPGIKG
PPGPPGAPGPPGLMGEKGKQGGDAIPGSAGEKGELGLLGALPGPRGLPGLEGDKGNEGSP
GLPGMYGVKGVMGDVGPIGPIGRTGPPGPPGFPGALIPGQKGNQGPPGLGGIKGDRGPPG
PPCEYTLGIKGEKGFPGNQGPTGQPGIIGDPGPPGHLGMPGTPGFPGSRGDPGFQGFPGM
TGEKGNLGPPGPFGPPGSIGPKGPPGQPGEPGTIKIISLPGSPGPPGRPGDPGMQGEPGA
QGPPGYPGLQGLRGSPGKPGKPGIPGPAGEKGNKGSKGEIGPPGSVGLPGLKGKPGNFGP
PATGPSIRGFIFTSHSQSTEIPSCPTGTVPLYSGYSLLFVQGNEQAHGQDLGTLGSCLQR
FTTMPFLFCNTNEVCNFASRNDYSYWLSTTAQMPMNMAPITGRALEPYISRCTVCEGPSM
AIAVHSQTTDIPLCPDGWISLWKGFSFVMYTSAGSEGSGQALASPGSCLQDFRANPFIEC
HGRGTCNYYSNSYSFWLASLNPRRMFRKPTPSTVKAGDLEKIISRCQVCMKRRD
NT seq 5025 nt   +upstreamnt  +downstreamnt
atgagccccgggggcgcgtccgggcgggtgctgccaatgttgctgctgactaggctgctg
ttgctgctacttcttgtggtggctcccgctatgggcaagggctgtgtctgttcagacaaa
ggtccatgtttctgtgacagcaggaaaggcgataagggtgagaaaggttttcctggttgt
cctggtactcctggccagaaaggactgcctggtccagaaggtatacctggacctcaggga
cccaagggctctccagggcttccaggctttattggttccaaaggcacaaggggaatgaca
ggattaccaggttttccaggtcctccaggacttccgggaactcctgggaatactggtcct
tatggacctcctggtttgccaggatgcaacggcactaagggggaccaaggatttccagga
cctccagggacaccaggtcttccagggttaccaggcaccaatggattaaaaggagaaaaa
ggagctccagctcgtgaagaaggcatagaaaatggtgaaagaggtgatcctgggttacca
ggaatcccaggacgtcagggtttgcctggccccccaggatttcctggaccacctggacca
caaggacccccaggatttttaggttttccaggagaaatggggcctccaggaccaaagggt
cacatgggtgttaaaggaattggagaaaaaggagatcggggtatgaaaggtttaacagga
ccccctggaccaccaggaacagttattataacacttactggaccagaaaacctaacggac
tacaaaggggataaaggagacaaaggatcagtgggtgagccaggacctccaggaccaaag
gggctacctggagaatcttatggatctgaaaaaggtgttcctggagaccctggtcctcgg
ggaaaacctgggaaagatggtgcccctggtttccctggatttccaggagctaagggtgaa
aagggtttccctggattaactggagaaactggcgctaagggatttaaaggagaccctggt
ccaggaggatttcgtggtccaacagaatattacaatggatacctggagaaaggcaatgat
ggaattcctggggctcctggacccaaaggagatcggggttcacatggacccagaggtcca
ccgggagatgttggtagacctggggcatcaagacctggtcttaggggtactccaggatct
cccggaatcaaaggaagtaaaggagaaagaggaccacctggagtgaatataatgggtcct
cctggacttcctggacttccagggaccccaggctccaaggggttacctggccttccagga
ccaccaggtaaagtaacttttcagaatggtcctccgggagaccatggagatccaggacat
ttggggtctccaggcatacctggagcctatggacccaaaggagaaccaggaccactgtgt
acccaatgtatttatactccaggacccccaggtctgccaggtttgcctgggttagatggt
gaaaaaggaactgaaggagggcaaggacctgatggcttaaagggaagcccaggatctcca
ggatatacaggtctaccaggctttccaggattcccaggtactccaggatatcagggacaa
aagggagaaaaaggtgaaacatcatatgaaggagaagtaggagatcgaggggatccagga
gtcagaggggagcctggaaaaaggggctccgatggaattcctggaaaacctggcacaaaa
ggactgccaggcacaaaaggagaaccggctgtgaatggtgaaaagggggataaaggtttt
ccaggaaatcctggtgaccctgggtacccaggacccatgggaccagctggaccatccaac
tatggaccaccaggacaacctggaccaaagggagctgcaggtgtacccggatttcctgga
tcacctggaaatgatggtcccaaaggagaaccaggtctagtagaaccagtccctggccct
ccaggacctcctggattgccagggctacctggcctcccaggtacaactggaaatccagga
tccaagggaccaagtggtaatccaggtcctcctgggtctgatggtgaagcaggattccca
ggaattggagttcctgggcctcctggatataagggagacagaggtgatccaggagccaaa
ggatcaccaggttgtccaggagaaatagggaaccctgggtcacctggactaccaggacta
ccaggagcaaagggagacccaggtacagcaatgcctggaaaagaagggatcactggtttt
caaggagaaaaaggaaatttgggggaaaatggagaaaatgggatccctgggcttccaggc
cttccagggcccccaggaaacaaaggacatgatggatcaccaggagagcctggctttcct
ggacctccagggtatgatgggattccaggaatctgtattccaggtgcaaagggaacccag
ggacttccaggtttaaatggactaaaaggaccacaaggagacagaggcctggaaggtcct
aaaggggatccaggaataccaggcttagacaggtcaggatccccaggggaacctgggcca
ccaggactgccgggtcatcaaggggataaaggacttagaggtcctgcaggatatccagga
gctccgggacccccaggtccaccaggccaaaagggagaagttggaataatgggttatcct
ggaacaattgggcctcctgggattcctgggaatccaggcactccaggacacaagggtaat
ttgggaattccaggaagaaagggacagaaaggacttcctggagtacaaggggaaagaggt
aataaaggaaatgaaggaccatcaatgatatcagatgatgtaggagagaaaggtgaacca
ggaccagaaggatctttgggaggccttggccaaaaaggagagagaggcactccaggtgta
ccaggatcacaaggctatgatggaatgcctggaaggccagggctaccaggactcagagga
gatcctggcaccatgggtcaccctggggaaccaggaccacctggaggacctggaagcatg
gggtacatgggaatgccaggtccaaagggaaaaaaaggaactgtaggtcacacaggtgaa
actggcagaccaggccttcctggtattcagggcatgaagggagagaaaggagaaccaggc
tatataagggacgcacggccgggacctccagggccaaagggagagccaggacccccagga
tccttaggtaagaaaggaggaagagggttaccaggtctaccaggtcctattggaccttct
ggagctgaaggaaaccagggaagttctggaaatcgtggccctccaggaaaccctggacct
gctggtgatttgggatttaaaggatgcaaaggtttccctggtcctccaggaataaaagga
ccgccaggtcctccaggtgctccaggacctcctggactaatgggtgaaaaaggtaaacaa
ggtggggatgcaattcctggttcagcaggagaaaaaggagaactaggtttactaggggca
cttccaggtccaagaggccttcctggtttagaaggagacaaaggaaatgaaggaagtcca
ggtttacccggcatgtatggtgtaaaaggtgtgatgggcgatgtaggaccaataggcccc
attggtaggacaggcccaccaggcccaccaggttttcctggtgcactaattccaggccaa
aaaggaaatcaaggtcctccaggcttgggaggaattaaaggagatcgtggtcccccaggc
ccaccttgtgaatacacattaggaataaaaggagaaaaaggttttccagggaaccaaggt
ccaactggtcaaccaggaatcataggagaccctggaccccccgggcatctgggaatgccg
ggtaccccaggtttcccagggtctagaggagatcctggatttcaaggatttcctggcatg
acaggtgaaaagggcaatctaggacctccaggaccatttggacctcctgggtcaattggg
ccaaaaggacctcctggtcaacccggagaacctggaacaattaaaattatatctctgcca
gggagcccagggcctcctggtcgacctggagacccaggaatgcagggagaaccaggagca
caaggaccaccaggatatccaggacttcaaggactaagaggttcaccagggaaaccagga
aaaccaggaatccctggaccagccggagaaaaaggcaacaaaggatctaaaggagaaatt
ggcccacctggatcagttggattgcctggattaaaaggaaagcctggaaactttggacca
cctgcaactgggccctccatcagaggctttatcttcaccagtcacagtcaatcaacagag
attccttcatgcccaacaggaacggtgcccctttatagtggctattcccttctctttgtg
cagggaaatgaacaagctcatggacaagaccttggaactcttggtagctgcctacaacgt
tttaccacgatgccattcttgttctgtaataccaatgaagtgtgcaattttgcttcacga
aacgactattcttactggctgtcaacaacagcacagatgcccatgaatatggctccaatt
actggcagagctctggagccttatattagcagatgtacagtctgtgagggtccttccatg
gccatcgctgttcacagtcaaaccacagacatccctttatgtcctgatggatggatttct
ctttggaaaggattttcttttgtcatgtacacaagcgcaggctcagaaggctctgggcaa
gcactagcatcgcctggatcctgcctacaagacttccgtgccaatccatttatagaatgc
catggcagaggaacctgcaactactattcaaattcttatagtttctggttggcttcctta
aatccaagaagaatgttcagaaaacctactccatccactgtgaaagccggggacctggaa
aagataatcagtcgctgtcaggtctgcatgaagagaagagactga

KEGG   Sarcophilus harrisii (Tasmanian devil): 100917586
Entry
100917586         CDS       T02286                                 

Gene name
COL4A4
Definition
(RefSeq) collagen alpha-4(IV) chain
  KO
K06237  collagen type IV alpha
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr04151  PI3K-Akt signaling pathway
shr04510  Focal adhesion
shr04512  ECM-receptor interaction
shr04926  Relaxin signaling pathway
shr04933  AGE-RAGE signaling pathway in diabetic complications
shr04974  Protein digestion and absorption
shr05146  Amoebiasis
shr05165  Human papillomavirus infection
shr05200  Pathways in cancer
shr05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:shr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100917586 (COL4A4)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100917586 (COL4A4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100917586 (COL4A4)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    100917586 (COL4A4)
  09154 Digestive system
   04974 Protein digestion and absorption
    100917586 (COL4A4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100917586 (COL4A4)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100917586 (COL4A4)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100917586 (COL4A4)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100917586 (COL4A4)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100917586 (COL4A4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:shr04147]
    100917586 (COL4A4)
   00536 Glycosaminoglycan binding proteins [BR:shr00536]
    100917586 (COL4A4)
Exosome [BR:shr04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   100917586 (COL4A4)
Glycosaminoglycan binding proteins [BR:shr00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   100917586 (COL4A4)
SSDB
Motif
Pfam: Collagen C4
Other DBs
NCBI-GeneID: 100917586
NCBI-ProteinID: XP_031813802
Ensembl: ENSSHAG00000013055
LinkDB
Position
3
AA seq 1687 aa
MALIKCSFRWLKQFVMGPWSLVIILFSIQQVYGGGKKYSGPCGGRDCSVCQCFPEKGSRG
QPGHLGPQGPIGDLGPPGPIGLPGEKGMKGDSGFPGPVGNQGDKGPTGVPGFPGLDGIPG
YPGPPGPRGKPGIDGRNGSRGDPGFPGERGVPGPEGPAGLQGPAGEKGNSVYISGAIKGL
PGDRGDPGSPGLPGPRGANGSMGEIGFPGIPGSRGPPGYPGRPGDQGNPGVGVKGQIGDP
GEVGLQGFPGPTLLIEPPGSCLIKGEKGMKGMPGVIGPSGPYGVKGEPGIGVKGEKGTSG
FPGPQGGPGSHGLPGFPGVKGELGASGVRGQLGVFGTKGDPGERGKPGPPGVLTTPPVPC
KGPPGDPGFPGLYGEKGSVGLPGPAGPPGRPGEVRIGMTGPPGPPGLPGLQGLQGEAGNP
GRGDSPAGKPGTPGHPGIPGVPGQQGQPGSDVIHCSTGPPGPQGVKGQSGPPGRRGTKGE
KGNEGLCSCCPGPLGLPGAPGPHGLQGRKGEVGLPGRVGEKGDPGSPGAQGSPGPPGIPG
TSGLTGPKGEKGDMVIARIKGRKGEKGHDGPPGYPGQEGVPGQNGLYGKRGEPGLPGSRG
GAIPGAEGSPGAPGSPGRMGPMGPPGLGFPGPEGVRGGPGKTGHPGVKGASGSKGQKGDT
YPCPSPYPGSPGAPGIPGAPGLKGFPGPPGEAGQPGFDGQKGQQGKSGISGILGPPGFRG
DPGESGPEGVEGLAPIGPPGPPGLPGINGQKGMPGDSAYGPPGLPGKMGPPGLPGLKGLR
GDPGFPGATGATGVPGFPGIKGIQGRKGNAGPPGNPGLPGHGCRGVPGLPGQPGLPGSPG
IPGFDGLKGHQGDRGPPGPAGMKGLPGIPGLPGSPGPPGPQGDPGYYGDNGSPGAPGPKG
AQGLPGIPGFPGERGRKGQIGLPGRKGDPGEEGLCGFPGEPGEPGSKGEKGYPGDQGDIS
IVSRKGEKGDLGPPGRYGFPGEKGDKGSPGIPGIKGFPGRDGLPGLQRGEPGKSGHPGLP
GPPGLPGPPGLRGIIGFPGIPGDKGELGLPGLPGLPGPHGTRGSKGNQGDDAASLFGPPG
PKGDPGIPGCPGYFGEQGDPGFPGPPGSSGLPGREGSAGYPGPPGFPGAPGIPGLKGYPG
EAGDPGPPGVRGDPGPPGPKGIKGSPGSPGLDGLPGLKGQKGLKGSSGLNEVGPPGQMGL
PGLKGKKGEPGRPGASCPGFPGDRGPLGPPGIPGLPGLPGPVGKTPEDEILPPGPLGDQG
PPGPDGPKGPPGPPGFPCSYDILKGDPGDDGQPGLPGPQGPPGPPGAKGFPGCEGKDGQK
GPMGYPGPPGPPGFPGPPGDKGLQGPPGRPGPTGPPGCQGEPGPPADTSSCPKIPGLPGV
PGPRGPEGKMGHPGQRGLPGSPGHKGERGVDGQRGLDGGPGPPGPPGSKGDPGEDGCGGA
PGPPGPTGDPGPKGSGTRYLNGFLLVLHSQTDKEPSCPEGMSKLWTGYSLLYLEGQEKAH
NQDLGLAGSCLPMFSTMPFAYCNINQVCHYARRNDKSYWLSSAAPLPMMPLSEDEIQAYI
SRCVVCEAPGQAMAVHSQDQAIPPCPPTWRSLWIGYSFLMHTGAGDQGGGQSLTSPGSCL
EDFRAAPFIECQGRQGTCHFFANEYSFWLTTVPPDSLLSSAPVPDTLKQERAQRQKISRC
QVCMKYS
NT seq 5064 nt   +upstreamnt  +downstreamnt
atggcattaataaagtgttctttcagatggcttaaacaatttgtaatgggtccttggtcg
cttgtaattattcttttttctatacaacaagtttacgggggtggaaaaaagtactctggt
ccttgtggaggacgagattgttcagtctgtcagtgttttcctgaaaaaggatctcggggc
caacctggtcatctagggccccaaggccccattggagatttaggacctcctgggcccatt
gggttaccaggagagaaaggaatgaaaggagacagtggatttcctggaccagtgggaaat
caaggagataagggcccaacaggagtacctggtttcccaggcttggatggcatacctggg
tatccaggacctccaggaccaagaggcaaacctggcattgatggccgcaatggttcaaga
ggagatccagggtttccaggagagagaggagtaccaggaccagaaggtccagctggtctt
caggggccagcaggagaaaaagggaattcagtgtatatttcaggtgctattaaaggcctc
ccgggagatcgaggtgatccaggatctccaggtttacctggacctcgaggggcaaatgga
tcaatgggtgaaataggatttccagggataccaggttctagaggacctccaggctatcct
gggaggccaggtgatcagggcaatccaggtgttggagtaaaaggccaaattggagatccg
ggtgaagttggtcttcaaggttttccaggaccaaccttactgattgaacctcctggttca
tgtctcattaaaggagaaaaggggatgaaaggaatgcccggtgtcattggtccctctgga
ccatatggagtcaagggtgaacctggtattggagtgaagggtgaaaaaggtacttctgga
ttcccaggacctcagggtggccctggttcccatggacttccaggttttccaggagtaaag
ggagaacttggagcaagtggtgtccgtgggcagcttggagtttttggcactaagggagat
cctggagagcgtggaaagccaggaccaccaggtgttttgacaaccccacctgttccttgc
aaaggacctccaggggacccaggattcccaggactctatggagaaaaggggtcagtgggg
ttgcctggtccagcaggaccccctggcagaccaggggaagtcagaataggaatgacagga
ccccctgggcctccagggttgccaggtttgcaaggtcttcaaggtgaagctggaaatcct
ggaagaggtgattcacctgcaggaaaaccagggactccaggacatccaggcataccagga
gtcccagggcaacaaggtcaacctggatcagatgtcatacattgtagcactggccctcct
ggaccacaaggagtgaaaggtcaatcaggacccccaggaagaagaggcacaaaaggagaa
aaaggaaatgaagggctgtgttcatgttgcccaggtcccctgggccttcctggtgctcca
gggccacatggtcttcagggtaggaaaggagaagtgggtctacctgggagagtaggagaa
aaaggtgacccaggctctcctggtgctcaaggatccccaggacctccaggaatacctggt
acctcggggctaactggtcctaaaggagaaaagggtgatatggttatagcaagaatcaaa
ggaagaaaaggagaaaagggtcatgatgggcctcctggatatccagggcaggaaggcgtt
cctggtcagaatggactgtatggaaaaagaggcgagccaggtctcccaggcagtcgtggc
ggagcaattccaggtgcagaaggatctcctggagcaccaggatctcctgggagaatggga
ccaatggggcctccaggactgggatttcctggcccagaaggggtgagaggtggaccaggg
aaaactggtcaccctggtgtgaagggagcatcaggttccaagggtcagaaaggtgacacc
tatccttgtccttccccctatccagggagccctggagctccagggattccaggtgctcca
ggtctgaagggatttccggggcctccaggtgaagctgggcaaccaggatttgatggacag
aagggccaacaaggcaaatcaggaatatcaggaatactgggaccacctggttttcgaggt
gaccctggagagtcaggtcctgaaggtgtagaggggttggcccctattggtcctccaggc
cctccagggttaccaggaatcaatggccaaaaaggaatgccaggtgattctgcttatgga
ccaccggggcttccaggaaagatgggccctccaggattgcctgggcttaaagggctcaga
ggggatccaggatttcctggagctacaggggcaactggtgttccaggattcccaggcatt
aaaggaattcaaggcagaaaagggaatgctggacctcctggtaacccaggtttgccaggc
catggatgccgaggtgttccagggttgccagggcaacctggactccctggatcaccagga
attccagggtttgatggcttgaaaggtcatcaaggagatagaggtcctcctggaccagct
ggaatgaaaggccttccaggaatcccaggacttccaggctcacctggacccccaggacca
caaggggatccaggctactatggagataatggctcaccgggtgccccaggtccaaaaggg
gcccaaggcctgccaggtatcccaggctttccaggagagcgaggaaggaaaggacaaatc
ggacttccaggtagaaagggtgacccaggagaagagggtctttgtggctttccaggagaa
ccaggagagccaggctctaaaggagaaaaaggctatccaggagatcaaggggatatttcc
atagtttcaagaaagggagaaaaaggtgatcttgggccacctggtagatatggattccca
ggagaaaaaggagataaagggagtcctggaatcccaggaataaaaggatttccaggaaga
gatgggctacctggattacaaagaggagaacctggcaagagtggacatccaggacttcca
ggccccccaggcctcccaggacctccagggctcagaggaataattggtttcccaggtatt
ccaggggacaagggtgagctgggcttaccaggcttgcctggactcccaggacctcatggg
acaagaggatctaaaggaaatcaaggtgatgatgcagcaagtctgtttgggccacctgga
ccaaagggagatccgggtatccctggatgtccaggatattttggagaacaaggagatcca
ggttttccaggccctccaggatctagtggactaccaggaagggaaggatctgctggatac
ccaggacctccaggatttccaggtgctccagggattcccgggctgaaagggtatcctggg
gaagcaggtgacccagggcctccaggggtcagaggcgatccaggaccaccagggcccaag
ggaataaaaggttcccctggatcaccaggattggatggcttgcctggactcaagggtcag
aaaggattaaagggtagttcaggcttaaatgaagttggtccaccaggccaaatgggactg
cctggacttaaagggaagaaaggggagcctggaagacctggagcttcttgtccaggtttt
cctggagacagaggtcctctaggtcctccaggcataccaggattgcctggacttcctggt
cctgtgggaaaaactcctgaagatgaaattcttccccctggtcctctgggagatcaaggt
ccccctggccctgatggaccaaaaggtccacctggaccaccaggttttccatgcagttat
gatatcctgaaaggagatccaggtgatgatggtcaaccaggtctacctggaccacaaggt
ccacccggacctccaggagccaaaggctttccaggatgtgaagggaaagatggccagaaa
ggtccgatggggtaccctgggcctccaggcccacctggatttcctggcccacctggagat
aaaggtttgcaaggaccccctgggagacctggccccactggtcctccaggttgtcaaggt
gaacctggcccacctgcagatacctcttcatgccccaaaatcccaggacttccgggggtt
ccaggcccaagaggaccagaagggaagatgggacacccagggcaacgaggtcttccaggc
tcaccaggacacaaaggcgagcgtggtgtggatggccaaaggggtttggatggtggtcct
ggtcctccaggaccacctggaagtaaaggagacccaggagaagacggctgtggaggggcg
ccaggtccccctggcccaactggggatccaggacccaaaggttctggaactagatacctt
aatggattcctactggttctccacagtcagacagacaaagaaccctcttgtcctgaggga
atgtccaagctgtggactggatatagcctgttgtatctggaaggccaggagaaagcacat
aaccaagacctaggtctggctggatcctgccttcccatgttcagcaccatgccatttgcc
tattgcaacatcaaccaagtctgccattacgccagaaggaatgacaaatcctattggctg
tcgagtgctgctcctctacccatgatgcccctctctgaagacgaaatacaagcttacatc
agccggtgtgtggtgtgtgaggctccaggtcaggcgatggctgtgcacagtcaggatcag
gccatccctccatgcccacccacctggagaagcctttggatagggtattcattcctaatg
cacacaggggcgggcgatcaaggcgggggccagtccctcacctcacctggaagctgcctg
gaagacttcagagccgcgccattcatcgagtgccaaggacggcaggggacttgtcacttt
ttcgctaatgaatacagcttctggctaaccacggtgccaccagactcgctgctctcctca
gctcctgtgccagacaccttaaaacaggaacgggcccagcgccagaagatcagcagatgc
caagtctgcatgaagtacagctaa

KEGG   Sarcophilus harrisii (Tasmanian devil): 100921255
Entry
100921255         CDS       T02286                                 

Gene name
LAMC1
Definition
(RefSeq) laminin subunit gamma-1
  KO
K05635  laminin, gamma 1
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr04151  PI3K-Akt signaling pathway
shr04510  Focal adhesion
shr04512  ECM-receptor interaction
shr05020  Prion disease
shr05145  Toxoplasmosis
shr05146  Amoebiasis
shr05165  Human papillomavirus infection
shr05200  Pathways in cancer
shr05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:shr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100921255 (LAMC1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100921255 (LAMC1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100921255 (LAMC1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100921255 (LAMC1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100921255 (LAMC1)
  09164 Neurodegenerative disease
   05020 Prion disease
    100921255 (LAMC1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100921255 (LAMC1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100921255 (LAMC1)
   05145 Toxoplasmosis
    100921255 (LAMC1)
SSDB
Motif
Pfam: Laminin_EGF Laminin_N Laminin_B
Other DBs
NCBI-GeneID: 100921255
NCBI-ProteinID: XP_031792874
Ensembl: ENSSHAG00000010160
LinkDB
Position
4
AA seq 1601 aa
MRGSPPRPLAALAPLLAAALLAGWATAAMDECADEGGRPQRCMPEFVNAAFNVTVVATNT
CGAPPEEYCVQTGVTGVTKSCHLCDAGQPHLAHGAAYLTDYNNQADTTWWQSQTMLAGVQ
YPSTINLTLHLGKAFDITYVRLKFHTSRPESFAIYKRTQEDGPWIPYQYYSGSCENTYLK
PNRGFIRTGGDEQQALCTDEFSDISPLTGGNVAFSTLEGRPSAYNFDNSPVLQEWVTATD
IRVTLNRLNTFGDEVFNDPKVLKSYYYAISDFAVGGRCKCNGHASECVKKDFDKLVCNCK
HNTYGVDCEKCLPFFNDRPWRRATAESASECLPCNCNGRSQECYFDPELYRSTGHGGHCT
NCQDNTDGANCERCRENFYRLGNEEACLPCHCSPVGSLSTQCDNYGRCSCKPGVMGDKCD
QCQPGFHSLTEAGCRPCSCNPAGSTDECNVETGRCVCKDNVEGFSCERCKPGFFHLESSN
PRGCTPCFCFGHSSVCTNAEGYSVHSITSTFQIDKEGWRAEERDGSETSLQWSSESQEIS
VISESYFPIYFIAPDKFLGNHLLSYGQNLTFSFRVERRDTRLSAEDLVLEGAGLRVSVPL
IAQGNSYPSETTVKYIFRLHEATDYPWRPTLTPFEFQKLLNNLTSIKIRGTYSERSAGYL
DDVTLASAQRGPGVPAVWVESCTCPVGYGGQFCQLCVSGYKRETPSLGPYSPCVLCTCNG
HSETCDPETGVCNCRDNTAGPHCEKCVDGYYGDSTAGTSSDCQPCPCPGGSSCAVVPKTK
EVVCTNCPTGTTGKRCELCDDGYFGDPLGENGPTRLCRLCQCSDNIDPNAVGNCNRLTGE
CLKCIYNTAGFYCDRCRDGFFGNPLAPNPADKCKACSCNPYGTVNQQTTCNQVTGQCECL
PHVTERDCSICDPGFYNLQSGQGCERCNCHALGSTNGQCDIRTGQCECQPGITGQRCEQC
EPNHFGFGPEGCKPCDCHPEGSLSLQCKDDGRCECKEGFVGNRCDQCEENYFYNRSWPGC
QECPACYRLVKDKVAEHRVKLQELENIIANLGTGDETVTDQAFEDRLKAAERDVMDLLRE
AQDIKDIDQNLMDRLQRVNNTLSSQISRLQNIRNTVEETGNLAEQARTRVESTERLIEIA
SRELEKAKVAIANVSITQPDSIGDPNNMTLLAEEARKLAERHKKEADDIVRVAKTANDTS
TEAYNLLLRTLAGENQTANEIEELNKKYEQAKNLSRDLEKQATRVHEEAKRAGDKAVEIY
ASVAQLTPVDSVALENEANKIKKEAEALDQMMDKKLSDYEDLREDMKGKELEVKDLLEKG
KAEQQTADQLLARADAAKALAEEAAKKGKNTLQEASDILSNLKDFDRRVNDNKTAAEEAL
KKIPAINRTIAEASEKTREAQLALGSAAADASEAKAKAREAERIAGAVQKNATSTKAEAE
RTFADVTNLDKEVDDMLKQLQEAEKELKKKQDDADQDMMMAGMASQAAQEAEINARKAKN
SVSSLLTIINDLLEQLGQLDTVDLNKLNEIEGTLNKAKDEMKVSDLDRKVTDLENEAKKQ
EAAIVDYNRDIEEIMKDIRNLEDIKRSLPSGCFNTPSIEKP
NT seq 4806 nt   +upstreamnt  +downstreamnt
atgcgcgggagcccgccgaggcccctggccgcgctggccccgctgctggcggccgcgctg
ctggcgggctgggctacggcggccatggacgagtgcgcggacgagggcgggcggccgcag
cgctgcatgcccgagttcgtcaacgccgccttcaacgtgaccgtggtggccaccaacacg
tgcggcgctccgcccgaggagtactgcgtgcagaccggggtgacgggggtcaccaagtcc
tgtcacctgtgcgacgccgggcagccccacctggcgcacggggccgcctacctgaccgac
tacaacaaccaggccgacaccacctggtggcagagccagaccatgctggccggggtgcag
tatcccagcaccatcaacctcaccctgcacctgggaaaagcctttgacatcacatatgtg
cgcctgaagtttcataccagtcgccctgagagctttgctatctacaaacggactcaggaa
gatgggccctggattccataccagtactacagtggttcctgtgagaatacctacttgaag
cccaaccgtggtttcatcaggacaggaggagatgaacagcaagcattgtgcactgatgaa
ttcagtgacatttctcctctcactggaggcaatgtggccttttcaacactggaaggaagg
cccagtgcctacaactttgacaatagccctgtgttgcaggaatgggtaactgccacagac
attagagtaactctcaatcgcctaaatacttttggagatgaagtatttaatgaccccaaa
gttttgaagtcttattattatgcaatttctgattttgcagtgggtggcaggtgtaaatgc
aatggacatgcaagtgagtgtgtgaagaaggactttgataagttggtatgtaattgcaaa
cacaacacttatggagtagattgtgaaaagtgtcttccattctttaatgaccggccatgg
aggagagcaactgcagagagtgccagcgaatgtttgccttgtaactgcaatggaagatca
caagaatgttactttgaccctgaactgtatcgttctacgggccatggtggccactgtacc
aactgtcaggataatactgatggtgccaattgtgaaagatgtcgggagaatttctatcgc
cttggaaatgaggaagcatgcctgccatgccattgtagccctgttggctctctcagtaca
cagtgtgataattatggacgatgtagctgtaagccaggtgtgatgggtgacaaatgtgat
cagtgccagcctggattccactctcttactgaggcaggatgcaggccatgttcttgcaac
cctgctggaagtacagatgaatgtaatgttgaaactgggcgttgtgtttgtaaagacaat
gtggaaggattcagttgtgagaggtgcaaacctggattttttcacttggagtcatctaat
cctcgaggctgtaccccttgcttttgttttgggcattcttctgtctgcacgaatgctgaa
ggatacagtgtccactctatcacttccactttccagatagataaggaaggatggcgtgct
gaagagcgggacggctctgagacatcactccagtggtcttctgagagccaggagatctct
gtgatctcagagagctactttcccatatacttcattgctcctgacaagtttttaggtaac
cacctgttgagttatggtcagaatctcactttctcctttcgagtggaaaggcgggataca
cgactctctgcagaagatctggtccttgaaggagctggtcttagagtatctgttccttta
attgctcagggcaactcctatcctagtgaaaccactgtgaaatacatttttagacttcac
gaagcaacagattatccctggagacctacccttactccttttgaatttcaaaaactatta
aataatttaacttctatcaagattcgtgggacatacagtgagagaagtgctggatatttg
gatgatgtcactttggcaagtgctcagcgtggacctggggtccctgcagtttgggtagag
tcctgtacctgccctgtgggatatggagggcagttttgtcaactgtgtgtctcaggatac
aaaagggaaacacctagtcttggaccttacagtccttgtgtgctttgtacttgcaatgga
catagtgagacctgtgatcctgagacaggtgtttgtaactgcagagataacacggctggt
ccacactgtgaaaagtgtgttgatggctactatggagattcaacagctggtacttcctct
gattgtcaaccttgtccatgcccaggaggctcaagttgtgccgttgttcccaagacaaag
gaggtggtatgcaccaattgtcccactggcaccactggtaaaagatgtgaactttgtgat
gatggctactttggagatccacttggcgaaaatggccccacaagactttgccgactttgt
caatgtagtgacaacattgatcccaatgcggttgggaattgtaacagattaactggagag
tgcttaaaatgcatctataacactgctggcttttattgtgaccgctgcagagatgggttt
tttgggaatcccctggcccccaatccagcagacaagtgtaaagcttgtagttgtaatcct
tatggtactgtgaatcaacagactacttgtaatcaagtaactggacagtgtgaatgcctc
cctcacgttactgagagggattgcagtatctgtgatcctggattctataatctacagagt
ggacaaggatgtgagagatgtaactgtcatgctctcggttccaccaatggccagtgtgac
atacgcactggacaatgtgaatgtcagccgggcatcactggccagcgctgtgagcagtgc
gagcccaaccactttggctttggacctgagggctgcaaaccatgtgactgtcaccctgag
gggtcactttcactccagtgcaaagatgatggtcgttgtgaatgcaaggaaggttttgtg
ggaaatcgctgtgaccagtgtgaagaaaattatttctataatcggtcttggcctggctgt
caagagtgtcctgcatgttatagactagtgaaagataaagttgctgagcatcgagtgaag
ctccaggagttagagaacattatagcaaaccttggaactggagatgaaacagttacagat
caagcttttgaggacagactgaaggcagctgagagagatgttatggacctactacgtgag
gcccaggacatcaaagatatagaccagaacctgatggatcgcctccagagggtcaataat
accctgtccagtcaaatcagtcgcttgcagaatatccgtaacactgtggaagaaaccgga
aatttagctgagcaagcccgcactcgagttgagagcacagaaagacttattgaaatcgct
tccagagaactggagaaagcaaaagtggccattgccaacgtgtcaattacccaaccagat
tctattggcgatcctaacaacatgactctgttggcagaagaagctcgtaaacttgctgaa
cgacataaaaaagaagctgatgacattgtacgggtagccaagacagccaatgatacatca
actgaagcctataatctactcctaaggactttggctggagagaatcaaacagcaaatgaa
attgaagaacttaataagaaatatgaacaagcgaaaaacctctcacgagatctagagaaa
caggctacccgagtacatgaagaagcaaaacgagctggagacaaagctgttgagatttat
gctagtgttgcccagctgacacctgtggattctgtggctcttgagaatgaggctaataag
ataaagaaggaagcagaggccctggaccaaatgatggacaaaaagctgagcgactacgag
gacctccgggaggacatgaaaggcaaggagcttgaagtgaaggacctcctggaaaaggga
aaggcggagcagcagacagctgaccaactcctggcccgcgccgacgcggccaaggctctg
gccgaggaggctgctaagaaggggaaaaacaccttgcaagaagccagtgacattctcagc
aacttgaaagatttcgacagacgagtgaatgacaacaagacggcagccgaggaagcccta
aagaagatcccggccattaaccgcacgatcgccgaggccagcgagaagacgcgggaagcg
cagctggccctgggcagcgcggccgccgacgcgtccgaggccaaagccaaggcccgcgag
gcggagcggatcgcgggcgccgtgcagaagaatgctaccagtaccaaagcagaggcagaa
agaacttttgcagatgttacaaatttggataaagaggtggatgacatgctgaaacagtta
caagaagcagaaaaggaactaaagaaaaagcaagatgacgctgatcaggatatgatgatg
gcaggaatggcttcacaggctgctcaagaagcagagattaatgcaagaaaggccaagaac
tctgttagtagccttctcaccatcatcaatgacctcttggaacaactcggacaactggac
actgtggacctgaacaagctcaatgagatcgaaggcaccctgaacaaagccaaagatgag
atgaaggtcagtgatctcgacagaaaagtaaccgatctggagaatgaagccaagaaacag
gaggctgccattgtggactacaacagagatattgaggaaatcatgaaagacattcgcaac
ctcgaagatatcaagaggagcttgccctcaggctgcttcaacaccccctccattgagaaa
ccctaa

KEGG   Sarcophilus harrisii (Tasmanian devil): 100921523
Entry
100921523         CDS       T02286                                 

Gene name
LAMC2
Definition
(RefSeq) laminin subunit gamma-2
  KO
K06246  laminin, gamma 2
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr04151  PI3K-Akt signaling pathway
shr04510  Focal adhesion
shr04512  ECM-receptor interaction
shr05145  Toxoplasmosis
shr05146  Amoebiasis
shr05165  Human papillomavirus infection
shr05200  Pathways in cancer
shr05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:shr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100921523 (LAMC2)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100921523 (LAMC2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100921523 (LAMC2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100921523 (LAMC2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100921523 (LAMC2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100921523 (LAMC2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100921523 (LAMC2)
   05145 Toxoplasmosis
    100921523 (LAMC2)
SSDB
Motif
Pfam: Laminin_EGF Laminin_B
Other DBs
NCBI-GeneID: 100921523
NCBI-ProteinID: XP_012403174
Ensembl: ENSSHAG00000011221
LinkDB
Position
4
AA seq 1189 aa
MSLLWLSCFCFFFLLPAALSTSRKEVCDCNGKSRQCVFDQELQRRTGKGFRCLNCNDNTA
GVHCERCKDGFYRLRDRDRCLPCNCNTKGSLSSRCDNHGRCNCKPGVMGDRCDQCQPGFT
LTEAGCSRNRQLKDSKCDCDPVGSTGSCDSGQCVCKASVTGERCDRCRPGYYHLDKDNPE
GCTQCFCYGHSATCSSSGVYSVYKITSTFHRDVDGWKAVHRNRAPAPLQWSQRHHDIFST
ARRSDPIYFVAPAKFLGNQQVSYGQSLSFDYRVDRGGRHPSTHDVILEGAGLRVSAPLMP
FGKTLPCGITKTYTFKLTEHPSSKWKPQLSYFEYRRLLRNLTALWIRATYGDYSTGYIDN
VTLISARPISGTPALWVEKCVCPAGYKGQFCQECAPGYKRDSAKLGPFGSCIPCNCPGGG
ACDPDTGDCYSGDENPDIDCADCPIGFYNDPQDPRNCKPCPCQNGFSCSVMPETEEVVCN
NCPQGITGARCELCADGYFGDPFGENGPVRPCQPCQCNNNIDPSAPGKCDHLTGECLKCI
YNTAGFHCDQCKEGYFGNPLATNPADKCRACNCNSVGSEPQRCRSDGSCICKPGFGGVSC
DHSALTNCPTCYNQVKIQLDQFLQQLQSLEALVLKIQAGGGSLPNAELEGRLKAAEGTLQ
DILREAQISEGSSRSLKLRLDKARAQETNYQSRLDELKMMANRMLALGNQYQSQVQDTRR
LIAKMRLSLEESKTSLSNTNIPPSDQYEGPNSFKTLAQEAWSLADSHVKSANEMERLAGE
TRDYSDQALELVRKAVIEGVGSSNVDSSVVQGLMGKFEEAKSLAQQLQRETGQADAETER
SYQQSLRLLNSMPQYPQITNQAFQMETKRIRQKADSLSSLVTRHITEYKNLQDHLGNWEK
ETEQLLQDGEKERQKSDQLLSRANLAKSRAQEALSMGNATFYEVESILKNLREFDLQVED
RKTEAENAMRRLPFISQMVAEADDKTGQAERALGSAAADARRAKSMAGEALEIADNIEQE
IGRLNLDANTTADAALALEKGMATLSSGIRDVEGELGRKELEFGQDGDAVQRVIQEAQGA
NTRAQNAGFAIQDTLNALDSILSLIDQPGGVDEEGLLLLEQNFSRARNQINTQLRPQMLE
LEDRVRKQQGHLRSLEANIAGILADVKNLEDIRNNLPPGCYNTQALEQQ
NT seq 3570 nt   +upstreamnt  +downstreamnt
atgtctctgctctggctgagctgtttctgcttctttttccttctgcctgcagccctgagc
acgtctaggaaggaagtttgtgattgtaatgggaaatcaaggcaatgtgtctttgatcaa
gagctgcaaagaaggacaggaaaaggattccgttgtctcaactgtaatgacaatacagct
ggtgtacactgtgagaggtgcaaggatggattttaccgcctgagagacagagaccgctgc
ttgccttgcaattgcaacacgaaaggctctcttagctcacggtgtgataaccatggaaga
tgcaattgtaagccaggtgtgatgggagacagatgtgaccagtgccagccaggattcact
ctcactgaagctggatgcagtcgaaatagacaattaaaagattccaaatgtgactgcgat
ccagtcggtagcacagggagctgtgattcaggtcaatgtgtctgcaaggcttcagtcact
ggagaacgctgtgataggtgtcggcctggttactatcatctggacaaagacaaccctgaa
ggatgcactcagtgtttctgctatggccactcagccacctgcagcagttctggagtttac
agtgtctacaagatcacttctactttccatcgagatgtcgatggctggaaggctgtccac
agaaacagagcgccggcaccacttcagtggtctcaacgccaccatgatatatttagtaca
gccaggagatctgaccctatctattttgtagctcctgccaaatttcttggaaaccaacag
gtgagttatggacagagtctctcttttgactaccgtgtggaccgaggaggaaggcaccca
tctacccatgatgtgattctggagggagctggtcttcgtgtctcagcccctttaatgcca
tttgggaagaccctgccatgtggaatcaccaagacatacacgttcaaactgactgaacat
ccaagcagtaaatggaaacctcagctgagttattttgagtaccgcagattattacggaat
ctgacagccctctggatcagagctacatatggagattatagcacaggatacattgacaac
gtgaccctgatctcagctcgtcccatctctgggaccccagcactatgggttgaaaaatgt
gtgtgtcctgctgggtataagggacaattctgccaagagtgtgcccctggatacaaaaga
gactctgccaaacttgggccttttggaagttgtataccatgtaactgtccaggtggagga
gcttgcgacccagacactggagattgttattcaggagatgaaaacccagacattgactgt
gctgactgccccattggtttctataatgatccccaggacccacgcaactgcaagccatgc
ccttgtcaaaatggcttcagctgctccgtgatgccagaaacagaggaagttgtctgcaat
aactgcccgcaagggatcactggtgctcgctgtgagctctgtgctgatggctactttgga
gacccctttggtgaaaatggtcctgtaagaccctgccagccctgtcagtgcaacaacaat
attgaccccagtgcacctggaaaatgtgatcacttgacaggggaatgcctgaaatgcatt
tataatacagctggcttccattgtgaccaatgcaaagagggctactttgggaatcctctg
gctactaatccagcggacaagtgtcgggcttgcaactgcaactcagtgggatctgagccc
caaaggtgtcgaagtgatgggagctgcatctgcaagccgggatttgggggtgtcagttgt
gatcattcagcattaaccaactgtccaacttgctacaaccaagtgaagattcagctggac
cagttcttgcagcaactgcagagcctggaggctctagttttgaagatacaggctggtggt
gggtccctacccaatgcagaactggaaggcaggttgaaggcagcggaggggacccttcag
gacattctgcgagaagctcagatctctgaaggctccagtaggtccctgaagctccgcctg
gataaggcaagggcccaagagaccaattaccaatcacgactggatgaactgaagatgatg
gcgaacagaatgctggccttggggaatcagtatcaaagccaagtccaggatacccggaga
ctgattgccaagatgagattgagtttggaggaaagcaaaacatccctaagcaatactaat
attccaccttcagaccagtatgaaggaccaaacagctttaaaacactagcccaagaagcc
tggagtttagcagacagtcatgtaaagtcggctaatgagatggaacgactggctggggaa
accagggattattctgaccaagccttggaactggttcgcaaagctgtgattgaaggagta
ggaagcagcaatgtggatagctctgtggtacaggggcttatgggaaaatttgaagaagct
aaatccctggcccagcagttgcagagggagaccggtcaagctgacgctgaaacagagaga
tcctaccagcagagcctgaggctcctgaactccatgcctcaatatccccagatcactaac
caggctttccagatggaaacaaagagaatcagacagaaagctgactctctgtctagtctg
gtaacaaggcacataacggaatacaagaatttgcaagatcacctgggaaactgggagaaa
gaaacagagcagcttttgcaggatggagagaaggagagacagaaatcggatcagctgctt
tcccgtgccaatcttgctaagagcagagcccaggaggccctgagcatgggcaatgcaact
ttttatgaagtggagagcattttaaaaaaccttagggaatttgatctgcaggtcgaggat
cggaaaacagaagcagaaaatgctatgaggagactcccctttatcagtcagatggttgca
gaggccgatgacaaaacagggcaggcagagagggccctgggcagtgctgctgcagatgcc
aggcgggcaaagagcatggcaggagaggcgctagagatcgctgataatattgagcaggag
atagggagattgaacttagacgcaaacacaacagcagatgcagccttggcacttgagaag
ggaatggccactctgagcagcgggatccgggatgtggaaggagagcttggaaggaaggag
ctggagtttggtcaggatggggatgctgtgcagagggtgattcaggaagcgcaaggggct
aataccagagcccaaaatgcagggtttgccatccaagatacactcaatgccttggacagc
atcctgagtctaatagaccagccgggcggagtggatgaagaaggcttactcttgctagaa
cagaacttcagcagagccagaaatcagataaacacccagcttcggccccagatgctggaa
ctggaggacagagttcggaagcagcaaggccatcttcggtccttggaggcgaacatcgcc
gggatcctggccgacgtcaagaacttggaggacatccgcaacaacctgcccccgggctgc
tacaacacacaggctctggagcagcagtga

KEGG   Sarcophilus harrisii (Tasmanian devil): 100922990
Entry
100922990         CDS       T02286                                 

Gene name
LAMB3
Definition
(RefSeq) LOW QUALITY PROTEIN: laminin subunit beta-3
  KO
K06244  laminin, beta 3
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr04151  PI3K-Akt signaling pathway
shr04510  Focal adhesion
shr04512  ECM-receptor interaction
shr05145  Toxoplasmosis
shr05146  Amoebiasis
shr05165  Human papillomavirus infection
shr05200  Pathways in cancer
shr05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:shr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100922990 (LAMB3)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100922990 (LAMB3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100922990 (LAMB3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100922990 (LAMB3)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100922990 (LAMB3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100922990 (LAMB3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100922990 (LAMB3)
   05145 Toxoplasmosis
    100922990 (LAMB3)
SSDB
Motif
Pfam: Laminin_N Laminin_EGF ATG16 Laminin_II F5_F8_type_C
Other DBs
NCBI-GeneID: 100922990
NCBI-ProteinID: XP_031793149
Ensembl: ENSSHAG00000010013
LinkDB
Position
4
AA seq 1167 aa
MWLLLMLMALPGLHAQQACSRGACYPPVGDLLVGRTRFLKASSTCGMTKPETYCTPYGEW
KMKCCKCDSRLPHGYNSHRVENVLSSSGPTRWWQSQNDVSPVSLQLDLDRKFQLQDIMLD
LQGPLPAGMLIEHSPDFGKTWKVYQYLAPNCAATFPQLRQGRPQSWQDVRCQPLSTQHTG
PNRGGKVHLNLLDLASGIPATQSQKIHELGEITNLRINFTRLASVPQRGYHPPSAYFAVS
QLRLQGSCFCHGHADSCAPLPGIPADPSARVQVHEVCVCQHNTAGLTCDRCAPFYNNRPW
KAADDQNPHECQRCECNGHSETCHFDPAVFAASQGVSGGVCDNCQDHTEGNNCERCQLHY
FRNRRPGAPIQETCIPCECDPDGAVPGAPCDPLTGQCVXKNVQGDTLDLSAGFTGLTTNP
RGCFCCDCSILGSRRDMPCDEETGRCLCLPNVVGPKCDQCAPNYWKVASGRGCEPCNCDP
HNSYSPQCNQFTGQCQCREGFDGPTCSAASIRQCPDRSYGDSGTACRACDCDFRGTEGPG
CDKTTGQCLCRPGFVGPRCDQCQRGFCDNYPICVVCHSCFQTFDRNIREEALRLRSLLNI
TAGLRPGSGLGDHVLGPRIGEAENSIRQIHAILRTPSVTEQEITEVANIIFSFRRTLQNL
QTNLPLEEETDSLLEELENLDRSLKLLLIQYQNKREQFERISSTDPSGSFRMLNSAYQTS
SQAVQRIASSSNLLLQVHDSRKEAERLERQLEGSGSAGGSQLQTLRQQMASFPNLTPTIN
KICGTTRQETCTPGQCQGITCPRDNGTACGADCRGILRQAGGAFRIAKQMSQQLQDFNAQ
LQQTRQMIREAEEAATQIQTDAQRLEIQVSNSRSQMEEDVRRTRLLIQQVRDFLTDPSTD
AATIQEISESVLALWLPTDSATVLRKMNEIQAIAARLPNVDLILSQTKQDITRARKLQEE
AELARSRAITVEGQVEDVVENLRQGMVALQEAEDTMLGTSRSLGLLQDRITEVQQVLAPT
ERMVTGMTEQLTSFRDRIEQLRHSIGEQREQSAQAQEIAQGASEHALSAQQGFERVKQKY
KELKNRMGQSPMLGEQGSRILNVKSEAEELFEETMTMMDRMKDMEVELLMGSQDIIRRSA
DLTGLEKRVEKIRDHINERVLYYATCQ
NT seq 3504 nt   +upstreamnt  +downstreamnt
atgtggctactccttatgttgatggcactgccaggactccatgcccagcaggcttgttct
cggggggcctgctaccctcctgtgggggacctgttggttggaaggacacggttccttaaa
gcttcctctacctgtggaatgacgaagcctgagacttactgtaccccatatggcgagtgg
aaaatgaaatgctgtaagtgtgactcccggctgcctcatggctacaacagtcaccgggtg
gagaatgtgctctcctcctccggccccacacgttggtggcagtcccaaaatgatgtgagt
cctgtttctctgcaactggatctggataggaaattccagctccaggacatcatgctggac
ttacagggacctctaccagcgggcatgctgattgaacattccccagactttggaaagact
tggaaggtgtatcaatacttggcccccaactgtgctgccaccttcccccagctccgccag
ggccggcctcaaagctggcaggatgttcggtgccagccactgtcaacccagcatactggg
cccaaccgtgggggaaaggtgcacctcaaccttttggacttagcatctggaattccggcc
actcagagtcagaagatacatgaactgggggaaattaccaacttgaggattaacttcacc
aggctggcttcagtgccccaaagaggctaccacccacctagtgcctattttgctgtgtca
caactgcgtttacaggggagctgcttctgccatggccatgctgacagctgtgctcctctc
ccaggcatccctgctgacccttcagctagagttcaggtccatgaggtctgcgtttgccag
cataatactgctggtctcacctgtgaccgctgtgctcccttctacaacaaccgaccttgg
aaagctgctgatgaccagaatcctcatgaatgccagaggtgtgagtgcaatgggcattcg
gagacctgccactttgacccagctgtatttgctgccagccagggggtgagcggaggtgtg
tgtgacaattgccaggaccacaccgaagggaacaactgtgagagatgtcagctgcactac
tttcggaaccgccgcccaggcgctcccatccaggagacctgcattccttgtgaatgtgac
ccagatggggcagtgcctggagctccctgtgacccactgactggacagtgtgtcnnaaag
aatgtacagggagacacgcttgacctatcagctggtttcactggactcactaccaaccct
agagggtgtttctgctgtgactgtagcatcctgggatctcggcgagacatgccctgtgat
gaggagactggccgttgcctctgtctgcccaatgtggttggtcccaagtgtgatcagtgt
gctcccaattactggaaggtggccagtggcaggggctgtgagccgtgcaactgcgaccct
cacaattcctacagcccccagtgtaaccagttcacaggtcagtgccagtgccgggaagga
tttgatggtccaacgtgcagtgctgcatctatccgccagtgtcctgatcggtcttatgga
gatagtgggacagcatgtcgagcctgtgactgtgacttccgggggacagagggcccaggt
tgtgacaaaactacaggtcagtgtctgtgtcgtccgggctttgttggtccccgttgtgac
caatgccagagaggcttctgtgacaactaccccatctgtgtggtctgccactcctgcttc
cagacatttgataggaacatccgagaggaagccctgcgtcttaggtccctgctcaacatc
acagctgggcttcggccagggtctggccttggggaccatgtgttgggcccccggatcggg
gaggcagagaacagcatccggcagatccacgcgatcctcagaacaccttcagtcacagag
caagagataactgaggtggcaaacatcatcttctctttcaggaggaccctccagaatctg
cagacaaatctgcccttagaagaggaaacagattcacttttagaagagctggagaatctg
gacaggagtcttaaactcctcctcatccagtatcagaacaagagagaacagtttgagaga
attagtagcacagatccttcaggttccttccgaatgctgaactctgcctaccagacatct
tcccaagctgttcaacgaattgctagcagttcaaacttgctgctccaagtccatgacagc
cggaaagaagctgaaaggctggagaggcagttggaaggaagtggaagtgctggtgggtca
cagcttcagaccctaagacaacaaatggcttcctttcccaatctgacacccaccatcaac
aaaatttgtgggaccacaaggcaggagacctgtaccccagggcaatgccaagggataacg
tgtccccgagacaatggcacagcctgtggtgctgattgtagaggcatcctccggcaggca
ggtggtgccttcaggattgctaagcaaatgtcccaacagctccaggacttcaatgctcag
ctccagcaaaccaggcagatgatcagggaagcagaagaagctgctacccagatccagaca
gatgcccaacgcctagagatccaggtgagcaacagccgttctcagatggaagaggatgtc
cgtcgtacccgcctcctcatccaacaggtccgggactttctcactgaccccagcacagat
gcagccaccatccaggagatcagtgaatcagttttggctctatggctgcctacggactca
gctacagtccttcggaagatgaacgagatacaggccattgctgccagattacctaatgtg
gacctgattctgtcacagaccaagcaggatattactcgggctcgaaaactccaggaggag
gcagaattggccaggagccgtgccattactgtggaaggtcaagtagaggatgtggttgag
aaccttcgacagggcatggtagctcttcaggaggcagaggacaccatgctaggtaccagt
cgctccctgggactcctgcaggatcggatcactgaggtccagcaggttcttgcaccaaca
gaaaggatggtgacaggtatgacagagcagctgactagcttcagggaccggattgaacag
cttcgccacagtatcggggagcagagagaacagtctgcccaagcccaggagattgcccag
ggagccagtgagcatgctctcagtgctcaacagggatttgagagagtgaaacaaaagtat
aaagaactgaagaaccgaatgggtcagagtcccatgctgggggagcaggggagccggatc
ctgaatgtcaagtctgaggctgaagagctctttgaggagaccatgactatgatggacagg
atgaaagatatggaagtagagctgctaatgggaagccaggacatcatccgacgttcagca
gacctgactggtttggaaaagcgtgtggagaagatacgggaccacattaacgagcgggtg
ctctactacgccacctgtcaatga

KEGG   Sarcophilus harrisii (Tasmanian devil): 100923249
Entry
100923249         CDS       T02286                                 

Gene name
COL4A2
Definition
(RefSeq) collagen alpha-2(IV) chain
  KO
K06237  collagen type IV alpha
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr04151  PI3K-Akt signaling pathway
shr04510  Focal adhesion
shr04512  ECM-receptor interaction
shr04926  Relaxin signaling pathway
shr04933  AGE-RAGE signaling pathway in diabetic complications
shr04974  Protein digestion and absorption
shr05146  Amoebiasis
shr05165  Human papillomavirus infection
shr05200  Pathways in cancer
shr05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:shr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100923249 (COL4A2)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100923249 (COL4A2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100923249 (COL4A2)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    100923249 (COL4A2)
  09154 Digestive system
   04974 Protein digestion and absorption
    100923249 (COL4A2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100923249 (COL4A2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100923249 (COL4A2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100923249 (COL4A2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100923249 (COL4A2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100923249 (COL4A2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:shr04147]
    100923249 (COL4A2)
   00536 Glycosaminoglycan binding proteins [BR:shr00536]
    100923249 (COL4A2)
Exosome [BR:shr04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   100923249 (COL4A2)
Glycosaminoglycan binding proteins [BR:shr00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   100923249 (COL4A2)
SSDB
Motif
Pfam: Collagen C4
Other DBs
NCBI-GeneID: 100923249
NCBI-ProteinID: XP_003765782
Ensembl: ENSSHAG00000009660
LinkDB
Position
3
AA seq 1704 aa
MGSRMYPTSRLARQRCLLLFVLITVLTERAHAGVKKYDVPCGGRDCSGGCQCYPEKGARG
QPGQVGPQGYDGPPGLQGIPGLQGRKGDKGERGAPGITGPKGDVGQRGVSGFPGADGIPG
HPGQGGPRGRPGSDGCNGTTGDAGTQGPPGSGGLPGLPGPQGPKGQKGEPYAFSPAERDK
YRGDSGEPGFIGLPGPVGYPGSPGKIGPVGAPGRPGPPGPPGPKGQPGNRGLGFYGEKGE
KGDVGRPGPTGLAPDSDLATSFLENVVDHLDQYKGEKGNWGEPGWKGISEKGEEGIVGFP
GQRGLPGNNGREGDQGEKGIRGDVGFPGIDGFKGLPGDIGDRGPPGPPSYSPHPSVIKGI
RGDPGDTGAYGPPGNPGAQGDPGQPGPPGTTIGDGDERRGLPGEMGAKGFIGDPGIPALY
PGPPGIDGKPGLPGKPGSPGPPGPDGFLFGLKGAEGNVGYPGPSGIPGTRGQKGWKGDPG
DCKCDIPSGLPGPPGPIGRPGANGEPGRKGEIGDPGAHGIPGFPGFKGNPGIPGLPGFKG
QKGDSKTITTKGSRGDQGNPGMPGLQGEDGFPGRDGLDGFPGLPGLPGDGIKGLPGDSGF
PGVPGLKGIPGESGPPGLGLPGPKGERGFPGDPGLSGSPGFPGPPGPPGTPGQTDCDGGV
KEPIGQEIIRPGCVIPPKGSQGLPGLPGSPGAKGQRGLPGLPGVDGFIGLKGFQGDAGRE
GFPGPPGFVGPRGSKGATGLPGLDGSPGSSGLPGSVGPAGQKGLPGEVLGAQTGLPGDPG
LPGIPGLKGEQGNRGPQGFRGSPGMPGMPGLKGQPGFPGPSGQPGLPGPPGTHGFPGPQG
QAGLPGLPGPSGFAGLPGDRGDRGDIGVPGPVGMKGLDGDRGDTGFIGEQGRRGEPGFQG
IPGLPGIPGTKGFKGSPGMEGFKGMLGIKGRSGIIGYKGEIGDFGIPGLKGLTGEPGLKG
SRGEPGPPGAPPKFLPGMKDFKGEKGDEGPVGGKGYWGIKGGQGMPGIPGQAGIPGLPGR
PGHIKGAKGEIGVPGVPGLQGFPGVIGSPGIRGFPGFVGVRGDKGMPGQEGLYGETGSIG
DSGDEGDTINLPGRPGLKGEVGTSGLAGEKGFTGEKGTLGDHGFTGLMGIKGSQGLPGLK
GQTGFPGLTGLPGPQGDPGRAGPPGEKGDQGWPGSPGLSGFPGIRGISGLHGLPGTKGFP
GSPGTDGYGNPGFPGLFGDKGERGEPNTIPGPLGAPGQKGERGTIGEQGPSGSPGPQGLP
GFTSPSNISGLPGDKGSPGLFGPQGYRGPPGAPGPTSFPGIKGEVGSPGFTGERGPKGWP
GDPGPQGRPGVYGLPGEKGPKGQQGLMGYHGIPGSIGDRGPKGPKGDRGFPGIPGAMGSP
GIPGVPLRIATEPGVAGPHGKRGPPGMQGEMGPQGPPGDPGLRGLPGKPGPQGRGGMSAL
PGFRGDEGPMGHQGPVGQEGEPGRPGSPGLPGMPGRSVSIGYLLVKHSQTDQEPMCPVGM
NKLWSGYSLLYFEGQEKAHNQDLGLAGSCLARFSTMPFLYCNPGDICHYASRNDKSYWLS
TTAPLPMMPVAEDEIKPYISRCSVCEAPAVAIAVHSQDVSIPHCPAGWRSLWIGYSFLMH
TAAGDEGGGQSLVSPGSCLEDFRATPFIECNGGRGTCHYFANKYSFWLTTIPEQNFQASP
SADTLKAGLIRTHISRCQVCMKNL
NT seq 5115 nt   +upstreamnt  +downstreamnt
atgggcagcagaatgtatccaacttccagacttgcccgacagcgatgtctgctgctgttc
gtgctgatcacggtgctaactgagagggcacatgctggtgtgaaaaaatatgatgtgcct
tgtggtggaagagactgcagtggaggttgtcaatgctatcctgagaaaggagcccggggc
caaccaggacaagttgggccacaagggtatgatggaccaccagggctacaaggtattcca
ggattacaaggacgcaaaggtgataaaggtgaacggggagcaccaggaataacaggaccc
aaaggagatgtgggacaaagaggtgtttctggatttcctggagctgatggaattcctggt
catccaggtcaaggtggacctcggggaagaccaggcagtgatggttgtaatggaactact
ggagatgctggtacacagggacccccaggttctgggggtttacctgggctccctgggcca
caaggacccaaaggtcagaaaggcgaaccttatgcattttctccggctgaacgagataaa
tataggggtgattcaggagaacctggttttattggtttaccgggacctgtaggttatcct
ggcagtccgggaaaaataggtcctgttggagcccctgggcgaccaggacctcctggacct
ccaggaccaaaaggacaaccaggcaacagaggtcttggtttttatggtgaaaagggtgaa
aagggtgatgttggacgaccaggacccactggacttgcaccagatagtgatcttgctact
tcctttcttgaaaacgtggtggaccatctagatcaatataagggtgaaaaaggaaactgg
ggagaaccaggatggaaaggaatttcagaaaaaggtgaagaaggaatagtgggctttcca
ggacaacggggtctgccaggcaacaacggtagagaaggagatcaaggagagaaaggaatc
agaggagatgttggctttccaggaattgacggctttaaaggactaccgggagacataggt
gaccgaggtccccctggaccaccttcatattcaccccatccttctgtcataaaaggtata
agaggtgatccaggagatacaggggcttatggtccccctggaaatccaggtgcacaagga
gatcctggccaaccaggtcccccagggacaacaataggagacggagatgaacgaagaggc
cttccaggtgaaatgggagccaagggttttataggtgatccaggaattccagccttgtac
ccaggacctccaggtatagatggaaaaccaggacttccagggaaacctggatctcctggc
ccaccaggaccagatggatttctttttggacttaagggagcagagggaaatgtgggttac
ccaggcccttcaggaatcccaggaacacgaggacaaaaaggatggaaaggtgatcctgga
gattgtaaatgtgatattcctagtggtcttcctggtccaccaggacccatcggtcgtcct
ggtgcaaatggagaacctgggaggaagggagaaattggtgatccaggtgcacatggtatt
cctggtttcccaggtttcaagggtaaccctggcattcctggattacctgggtttaaagga
cagaaaggagactctaaaacaattacaacaaaaggtagcagaggtgatcaaggcaatcct
ggcatgcctggtttgcaaggtgaagatggctttccaggacgagatggactagatggtttt
ccaggccttccaggtcttcctggtgatggcatcaaaggccttccaggagattcaggtttc
ccaggagtacctggtttaaaaggcattccaggagaaagtggtcctccaggcctaggtcta
cctggcccaaaaggtgaacgaggctttcctggtgaccctggattaagtggaagtcctggc
ttcccaggccctccaggccccccaggcactccaggccaaacagattgtgatggaggtgtg
aaagagccaattggccaggagataatccgacccggttgtgtaataccacctaaaggatct
caagggttgcctggacttccaggatctccaggtgctaaaggtcaaagaggacttccagga
ttaccaggcgtagatggatttattggacttaaaggattccaaggagatgcaggtcgtgaa
ggatttccaggaccaccaggatttgttggacccagaggatccaaaggtgcaacagggctc
cctggactggatggaagcccaggctcttcaggattaccaggttctgtaggaccagcagga
caaaaaggattacctggagaagtattaggtgcacagactggtctcccaggagatcctgga
ttgcctggaatcccagggttgaaaggagaacaaggaaataggggacctcaaggatttaga
ggaagcccaggtatgcctggaatgcctgggttgaaaggtcagcctggattcccaggtcct
tcaggtcaacctggattaccagggcctccaggaacacatggctttccaggacctcaaggc
caagcaggactaccaggtcttccaggaccttcaggatttgcaggtctacctggtgataga
ggtgatcgaggtgacataggagtccctggccctgtggggatgaaaggtctggatggtgat
agaggtgatactggttttataggagagcaaggcagacgaggagaacctggatttcaaggg
atacctggattgcctggcatcccaggaacaaaaggtttcaaaggatctcctggtatggaa
ggtttcaaaggcatgctgggcatcaaaggaagatcaggaatcattggatataaaggagaa
attggcgattttggaattcctggtttgaaaggtctaactggtgaaccaggcttgaaaggt
agccgtggagaaccaggacctccaggagcacctccaaaatttctgccaggaatgaaagac
ttcaaaggagaaaaaggagatgaaggacctgttggagggaagggatattggggcataaaa
ggtggacaaggaatgccaggcattcctggacaggcaggaattcctgggttacctggaaga
cctggtcacatcaaaggggccaaaggtgaaatcggtgttcctggagtgcctggtttgcaa
gggttccctggtgtaataggttctcctggtatcagaggttttcctggatttgtaggtgtt
aggggtgacaagggtatgcctggacaagaaggtctttatggtgagactggaagtatagga
gattctggtgatgagggagacactataaatttaccaggaaggccagggttaaagggagaa
gtgggcacatctggacttgcaggtgaaaagggattcactggagaaaaaggcacactagga
gatcatggtttcacaggactgatgggcataaaaggatcccaaggcctccctggactgaaa
ggacagacaggttttccaggactgacaggactcccaggaccccaaggagacccaggtcgt
gctggacctcctggtgaaaagggagatcaaggatggccagggagtccaggcttatcaggt
ttccccggcatcagaggaatcagtggattacatggcttaccaggcaccaaaggcttccct
ggatctccaggtacagatggctatgggaatcctggctttcctggtctttttggtgacaaa
ggagaaagaggagagcccaacacaattcctggccccctgggagcaccaggacagaaggga
gaaaggggaaccataggggaacaaggcccatctggtagcccaggacctcaaggacttcca
ggattcacttcaccttccaatatctctgggttaccaggtgacaaaggatccccaggttta
tttggaccacagggttaccgaggcccccctggagcacctggaccaacatctttccctgga
atcaaaggagaagtaggaagtccaggatttacaggagaaaggggacccaaaggatggcca
ggagatcccggaccccagggcagacctggagtatatggactcccaggagaaaaaggaccc
aaaggacaacaaggacttatgggataccatgggataccaggaagtattggtgacagaggc
cccaagggacctaaaggagatagaggattccctggcattcctggtgctatgggatctcct
gggattccaggagtccccctgaggattgctacagaacctggggtggcaggtccccatgga
aagagagggccccctggaatgcaaggagagatgggtccccaaggtcctccaggtgatcca
ggtttgcgaggactgcctggaaaaccaggtccccaaggaagaggtggtatgtcagccctt
ccaggattcagaggtgatgaaggtcccatgggtcatcaaggaccagtaggccaagaaggt
gaaccaggccgaccaggaagtcctgggctacctggaatgccaggccgtagtgttagcatt
ggttatctcctggtgaaacacagtcagactgatcaagagccaatgtgtccagttggcatg
aataaactctggagtggatatagtctactatactttgaaggccaggaaaaagcacacaac
caagatcttggactggctggctcgtgcttggcccgtttcagcaccatgcctttcctgtac
tgcaaccctggagacatctgccattatgccagccggaacgacaaatcctactggctctca
acaactgcaccactgcctatgatgccggtggcagaagacgaaattaaaccttatatcagc
cgttgctctgtatgcgaagcccctgccgtggccattgccgtccacagccaagatgtctcc
atcccccactgtcctgcagggtggcgcagcttatggattggctactcctttctcatgcac
acagccgcgggggacgagggcggcggacagtcgctggtgtctcccggaagctgtctggag
gacttccgggccacgccttttatcgaatgcaacggcggccgaggcacctgccactacttc
gccaacaagtacagcttttggcttaccaccattcccgagcagaacttccaggcctcccca
tcggcagacaccctgaaggccgggctcatccgaactcacatcagccgctgccaggtctgc
atgaagaacctttaa

KEGG   Sarcophilus harrisii (Tasmanian devil): 100923506
Entry
100923506         CDS       T02286                                 

Gene name
COL4A1
Definition
(RefSeq) collagen alpha-1(IV) chain
  KO
K06237  collagen type IV alpha
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr04151  PI3K-Akt signaling pathway
shr04510  Focal adhesion
shr04512  ECM-receptor interaction
shr04926  Relaxin signaling pathway
shr04933  AGE-RAGE signaling pathway in diabetic complications
shr04974  Protein digestion and absorption
shr05146  Amoebiasis
shr05165  Human papillomavirus infection
shr05200  Pathways in cancer
shr05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:shr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100923506 (COL4A1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100923506 (COL4A1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100923506 (COL4A1)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    100923506 (COL4A1)
  09154 Digestive system
   04974 Protein digestion and absorption
    100923506 (COL4A1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100923506 (COL4A1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100923506 (COL4A1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100923506 (COL4A1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100923506 (COL4A1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100923506 (COL4A1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:shr04147]
    100923506 (COL4A1)
   00536 Glycosaminoglycan binding proteins [BR:shr00536]
    100923506 (COL4A1)
Exosome [BR:shr04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   100923506 (COL4A1)
Glycosaminoglycan binding proteins [BR:shr00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   100923506 (COL4A1)
SSDB
Motif
Pfam: Collagen C4
Other DBs
NCBI-GeneID: 100923506
NCBI-ProteinID: XP_003765783
Ensembl: ENSSHAG00000011617
UniProt: G3WDT4
LinkDB
Position
3
AA seq 1668 aa
MSPRPVVWLLLLLAALLLNEEQSKAAAKGCSGSGCGKCDCNGVKGQKGERGLPGLQGVIG
FPGMQGPEGPHGPPGNKGDAGEPGLPGTKGTRGPPGSSGYPGNPGLPGIPGQDGPPGPPG
IPGCNGTKGDRGPVGPPGLPGFSGIAGPPGLPGMKGDPGEILSLIPGMPLKGERGFPGAP
GPMGPRGNPGLPGMDGPPGYSGPPGPPGPPGLPGEKGQMGLSFQGPKGDKGEQGVSGPPG
EPGQAQVGKKGDLITQGPKGQKGEPGAPGMPGEREKGEPGKPGPRGKPGKDGEKGEKGSP
GLKGDAGFPGIPGQTGAKGERGFPGPQGLPGTVISTQPGGEKGEKGYPGAPGLKGEPGQK
GYPGIPGQPGPPGFPVPGQIGAPGFPGERGEKGDPGPPGQSLPGTSGRDGFPGLPGPPGP
PGLPGHTNGIVECQPGPPGDQGPPGSAGLPGLTGEMGQKGEKGQGCLTCDLDGVPGLPGP
QGPPGEIGFPGQPGAKGDRGLPGHNGLEGMPGPPGLPGLRGEPGAKGEPGEIYLDAKLKG
DKGEPGFPGQPGAPGRAGTPGRDGHPGLQGPKGSPGSIGLKGDRGPPGGVGFPGSRGDIG
PPGPPGFGLPGPVGDKGQAGFPGSPGSPGLPGPKGEAGKVVPLPGPPGAEGVPGPPGFPG
PQGDRGFPGSPGRQGPPGEKGSVGQPGIGFPGPPGPKGVDGLPGAIGQPGNPGRPGFDGL
PGNPGVPGQKGEPGVGLPGPKGSAGLPGIPGRPGEKGNVGGPGIPGEHGLIGPPGLQGLR
GDPGLQGIQGPKGAPGAPGIGPPGVMGPPGGQGPPGSAGPPGIKGEKGYPGFPGSDMPGP
KGDKGSPGLPGLTGQIGLPGPPGTQGTPGLPGFPGPKGEMGVMGTPGQPGPPGPVGSPGF
QGLKGDQGFPGTTGPRGDPGFKGDKGDAGLPGQPGSMDKVDMDSMKGQKGDQGEKGQTGP
IGDKGARGDPGTPGVPGKDGQAGTPGQPGPKGDQGLGGSPGAPGLPGPKGSVGGMGLPGS
PGEKGAQGIPGSQGIPGFPGLKGEKGVKGEAGRPGIGTPGLPGEKGDTGPSGFPGRPGEK
GEKGSPGMPGMPGPPGPGGLPGNVGYPGSPGMPGEKGDKGLPGLDGVPGVKGDAGQPGLP
GPAGPGGQKGEPGGDGIPGSAGEKGEPGLPGRGLPGFPGSKGEKGSKGELGFPGSAGSPG
IPGLKGEPGFMGPPGPPGQQGLPGVPGRAVEGPKGDRGPQGQPGIPGVPGPMGPPGLPGL
DGAKGEKGNPGWPGSPGAPGAKGDPGFQGMPGIGGTPGITGSKGDMGPPGVPGFQGAKGS
PGLQGLKGDQGDQGLPGSKGLPGPPGSPGPYSLIKGEPGIPGPEGPVGLKGIPGPPGPKG
QQGVTGSVGIPGPPGNPGFDGAPGQKGEPGPFGPPGPKGHPGPPGPDGLPGSMGPPGTPS
VDHGFLVTRHSQTIDDPQCPPGTKIIYHGYSLLYVQGNERAHGQDLGTAGSCLRKFSTMP
FLFCNINNVCNFASRNDYSYWLSTPEPMPMSMAPISGENIRPFISRCAVCEAPAMVMAVH
SQTIQIPQCPSGWSSLWIGYSFVMHTSAGAEGSGQALASPGSCLEEFRSAPFIECHGRGT
CNYYANAYSFWLATIERNEMFKKPTPSTLKAGELRTHVSRCQVCMRRT
NT seq 5007 nt   +upstreamnt  +downstreamnt
atgagtccacggccggttgtttggctgctgctgttgctggctgccctcctgctcaacgag
gagcagagcaaagcagctgcaaagggttgttctggttctggctgtggaaaatgtgactgc
aatggagtaaaaggacaaaaaggtgaacgaggtcttccaggattacaaggtgttatcggg
tttcctggaatgcaagggcctgaaggtccacatgggcctccgggtaataagggggatgct
ggagaaccaggactaccaggaacaaaaggaacgagagggccaccaggctcatctggttat
cctggaaaccctggacttcctggtattccaggccaagatggtccaccaggtcctcctgga
atcccaggatgcaatggtacaaagggtgatagaggtccagtgggtcctcctggtttgcct
ggattttctgggatagcaggcccccctggattgccaggaatgaagggagacccaggtgaa
atccttagtctaatcccaggcatgccattgaaaggtgaaaggggatttcctggagcccct
ggaccaatgggtccaagaggaaacccagggttaccaggcatggatggtccaccaggatat
tcgggaccacctggtccaccaggtcctccaggacttccaggtgaaaagggtcaaatgggt
ttgagttttcaaggacccaaaggtgacaagggtgaacaaggtgttagtggacctccaggt
gaaccaggacaagctcaagtaggaaaaaagggagatcttattactcagggaccaaaaggt
caaaaaggagaacctggagctcctggaatgccaggtgaaagagagaaaggtgaacctggt
aaaccagggcctcgagggaaacctggaaaggatggtgaaaaaggagaaaagggaagtcca
ggtctaaaaggtgatgcaggattcccaggaatcccaggccaaacgggtgctaagggagag
agaggattcccaggccctcaaggattaccaggcactgtgataagcacacaaccagggggt
gaaaaaggagagaagggatatccaggtgctccaggattaaaaggcgaaccaggtcaaaaa
ggttatccaggtattccaggccaaccaggtcctccaggcttcccagtccccggacaaatt
ggtgctcctggctttcctggtgaaaggggagaaaagggtgatccaggtcctccaggacaa
tcattgcccggaacaagtggaagagatgggttcccaggacttcccgggcctcctggacct
cctggcttaccaggccatacaaatggaatagtggaatgccagcctggaccacctggagat
caaggaccaccgggaagtgctgggctaccaggattgacaggggagatgggacagaaaggt
gagaaaggtcaaggctgcctaacctgtgatctggatggagttcctggacttccaggtcca
caaggaccaccaggggaaataggttttccaggacagccaggtgctaagggagacagaggt
ttacctggacataatggtcttgaagggatgcctgggcctccaggtttgccaggactgagg
ggtgagccaggagcaaagggagagcctggagagatttatttggatgcaaagctgaagggt
gacaaaggagagccaggttttccaggacaacctggtgcccctggaagagcaggaacacct
ggaagagatggccatcctggtcttcagggccccaaaggatcaccgggttcaataggacta
aaaggagaccgtggtccccctggaggagttggttttcctggaagtcgtggtgacataggc
cctcctggcccaccaggatttggcctacctggtccagttggtgacaaagggcaagcaggt
tttccaggaagccctgggtccccaggtctcccaggtcctaagggtgaagcaggaaaagtg
gttcctctacctggtcccccgggagcagaaggagttccaggacccccaggtttcccagga
ccccaaggtgacagaggttttcctggcagcccaggaagacaaggacctccaggagaaaaa
gggtctgttggccaaccaggaatagggtttccaggacccccaggaccaaaaggtgttgat
ggcttgcctggagctataggtcagcctggaaatccaggtcgtccaggatttgatggttta
ccaggaaatccaggtgttccaggccaaaaaggtgagcctggagttggtctcccaggtccc
aaaggatcagcaggtcttcctggcattcctggacgccctggtgaaaaggggaatgttggt
ggaccagggatcccaggagaacatggacttatagggccacctgggctacaaggactcaga
ggtgacccagggctgcaaggaatccaaggcccaaaaggtgcccctggtgctccaggaata
ggccctcccggagttatgggcccccctggaggacaggggccaccaggatcagcaggtcct
cctggaatcaaaggagaaaagggttaccctggattcccaggatcagatatgccaggaccc
aaaggagataagggaagtccaggtcttcctggcttaacaggtcaaataggattacctggg
cctcctggcacacaagggactcctggacttccaggttttccaggtcccaagggagagatg
ggagtaatgggaacccctggtcagccaggtcctcctggaccagtaggttctccaggtttc
caaggactaaaaggtgaccaaggtttcccaggtacaacaggacccaggggtgatccaggt
ttcaaaggtgataagggtgatgctggtctccctggacagccaggatcaatggataaagtg
gacatggacagtatgaagggccagaaaggagatcaaggagaaaagggacaaactgggcca
attggagataaaggagccagaggagatcctggcactccaggagtacctgggaaggacgga
caagcaggaactcccggccagccaggtcctaaaggtgatcaaggtcttgggggatctcca
ggtgctccaggactaccaggaccaaagggttctgttggtggaatgggtttgccagggtca
cctggagaaaaaggagcacaaggaatcccaggttctcaaggtatcccaggcttcccagga
ttaaaaggagaaaagggagtgaaaggagaagcaggtcgcccaggcattgggactcctgga
cttcctggtgaaaagggagacactggaccttcaggtttcccaggaaggcctggagaaaag
ggagaaaaaggaagcccagggatgccaggaatgcctggtcctccaggtcctggaggatta
cctgggaatgtaggctatccagggagccctggaatgcctggagagaagggtgacaaagga
cttcctggtttggatggtgttcctggagttaaaggagatgcaggtcagcctggtcttcca
ggtccagcaggtccaggtggtcaaaaaggtgaaccaggtggtgatggaattccaggatca
gctggtgagaagggtgaaccaggtcttccaggaagaggacttccaggatttccaggttcc
aaaggagaaaaaggttccaagggagagttgggtttcccaggatcagcaggaagtccagga
attcctggactcaaaggagaaccaggatttatgggtcctccgggtcccccaggacaacaa
ggattacctggagttcctggtcgagcggtagaaggtcctaaaggagacaggggtccacaa
ggtcaacctggcatacctggtgttcctggacccatgggccctcctggccttccaggactt
gatggagcaaaaggagaaaaaggaaatccaggttggccaggatccccaggtgctccagga
gctaagggagatccaggatttcagggaatgcctggtattggtggtacaccaggaatcact
ggttctaagggtgatatgggacctccaggtgttccaggatttcaaggtgccaaaggttct
cctggcctccaggggctcaaaggagatcaaggggatcagggactaccaggttcaaaaggt
cttccaggaccacctggttccccaggtccttatagcctaatcaaaggagagccaggtatc
cctggacctgaagggccagtcgggcttaaaggtattccaggccctccaggccctaaagga
caacaaggtgtaacgggctctgtgggtattcctggaccacctggtaacccaggatttgat
ggtgcacctggacaaaaaggagaaccaggcccttttggtcctcctggtccaaaaggacat
cctggtccacccggtccagatgggcttccagggtcaatgggtccaccaggtaccccctct
gtagatcatggcttccttgttactaggcacagtcaaaccatagatgatccacaatgccct
cctgggaccaaaataatttaccatggctattccttgctctacgtacaggggaatgaacgt
gcacatggtcaggacttgggtacggctggaagctgtttgcgaaaattcagtactatgcca
tttctcttctgcaatattaacaatgtttgcaactttgcatcaagaaatgactactcttat
tggttgtctactcctgagcccatgccaatgtcaatggcacctatctctggtgaaaacatt
aggccttttattagtaggtgtgctgtatgtgaggctcctgccatggtgatggcagtccat
agtcagacaatccaaataccacagtgtcccagtggatggtcatcactttggattggctat
tcttttgttatgcacaccagcgctggtgccgaaggttctggccaggcactagcatcccct
ggttcctgtctggaagaatttagaagtgcacccttcattgaatgccatggtcgtgggact
tgtaattattatgcaaatgcttatagcttctggcttgctactatagaaagaaatgagatg
ttcaagaagcctactccatcaactttaaaagcaggagaactgcgcacacacgttagccgc
tgccaagtctgtatgagaagaacataa

KEGG   Sarcophilus harrisii (Tasmanian devil): 100924495
Entry
100924495         CDS       T02286                                 

Gene name
LAMA2
Definition
(RefSeq) laminin subunit alpha-2 isoform X4
  KO
K05637  laminin, alpha 1/2
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr04151  PI3K-Akt signaling pathway
shr04510  Focal adhesion
shr04512  ECM-receptor interaction
shr05145  Toxoplasmosis
shr05146  Amoebiasis
shr05165  Human papillomavirus infection
shr05200  Pathways in cancer
shr05222  Small cell lung cancer
shr05410  Hypertrophic cardiomyopathy
shr05412  Arrhythmogenic right ventricular cardiomyopathy
shr05414  Dilated cardiomyopathy
shr05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:shr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100924495 (LAMA2)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100924495 (LAMA2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100924495 (LAMA2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100924495 (LAMA2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100924495 (LAMA2)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100924495 (LAMA2)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100924495 (LAMA2)
   05414 Dilated cardiomyopathy
    100924495 (LAMA2)
   05416 Viral myocarditis
    100924495 (LAMA2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100924495 (LAMA2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100924495 (LAMA2)
   05145 Toxoplasmosis
    100924495 (LAMA2)
SSDB
Motif
Pfam: Laminin_G_1 Laminin_EGF Laminin_G_2 Laminin_N Laminin_B Laminin_I Laminin_II Laminin_G_3 FAM25 Rbsn
Other DBs
NCBI-GeneID: 100924495
NCBI-ProteinID: XP_023358970
Ensembl: ENSSHAG00000015297
LinkDB
Position
4
AA seq 3142 aa
MPGHAWHFLLLFFTGLGSPESTRAQQQQQQQQQQRPPTHLLPTHQQRGLFPAVLNLATNA
LITTNATCGDRGPEMYCKLVEHVPGQPVRNPQCRTCNQNSSFAYQRHPITNAIDGKNTWW
QSPSIKNGIEYHYVTITLDLQQVFQIAYVIVKAANSPRPGNWILERSLDGFEYKPWQYHA
ITDTECLTRYGIYPRTGPPSYAKDDEVICTSFYSKIHPLENGEIHISLINGRPSADDPSP
ELLEFTSARYIRLRFQRIRTLNADLMMFAHKDPREIDPIVTRRYYYSVKDISVGGMCICY
GHARACPLDPLTNKSRCECEHNTCGDSCDQCCPGFHQKPWKAGTFLTKTECEACNCHGKA
EECYYDENVASRNLSLNIHGKYIGGGVCINCTQNTTGINCETCIDGFFRPKGILPNYPRP
CQPCYCDPIGSLNEICVKDENHARRGLFPGSCHCKHGFGGVRCDRCARGYTGYPDCVPCN
CSGIGSTNEDPCIGPCYCKENVEGRDCSHCKVGFFNLQENNRKGCEECFCSGVSDRCQSS
RWTYSSINDMDGWYLTDVAGLLRITPHQDSSGQSQQLSINSLDAKRELPRIYYWSAPEPY
LGNRVTAAGGQLKFTISYDLIGEDDLENVLQLMIILEGNGLQISTTQEEIYLPPSKEYTH
VVLLSSELFNVHDTGSRISRKEFMTILANVKRLLIQATYILGMDAIFRLNSVSLESAVPY
PTDGELADAVELCQCPPGYSGSSCESCWPGHRRVNGTIFGGICEPCQCFGHAEACDDITG
ECVGCKDHTGGPYCNRCLPGFYGDPTKGTTEDCHPCACPLNIPSNNFSPTCHLDWSRELI
CDECPVGYTGPRCERCAEGYFGQPSVPGGSCQPCQCNDNLDFSIPGSCDSLSGSCLICKP
GTSGRYCERCADGYFGDAVDAKNCQPCRCNLNGSFSEICHTQTGQCECKPNVQGLRCDEC
QPQTFGLQSSQGCVPCNCNSFGSKSFDCEESGQCWCQPGVAGKKCDRCAHGFFNFQEGGC
TSCECAHLGNNCDPNTGKCICPPNTIGDKCDKCAPNSWGHSIIHGCKACNCSLVGSFDFQ
CNINTGQCSCHPEFSGRKCSECNLGHWNYPHCDVCDCFLAGTDASTCSSETGKCACLNQS
GQCTCKVNVEGVHCDRCRPGKFGLDAKNPLGCSSCYCFGTTTQCTEAKGLIRMWVTLTPE
QTILPLVDEALQHTTTKGIAFQNPEIVAEMEQVREDLHLEPFYWKLPEQFEGKKLMAYGG
KLRYTIYFEAREETGFFTYNPQVIIRGGTPAHARIITRHMAAPLIGQLTRHEIEMTENEW
KYYGDDPRTSRMVTREDFLDVLYDIHYVLIKATYGNVIRQSRISEISLEVAEQGVISALS
PRARLIEKCDCPLGYSGFSCEACMPGFYRLPSESGGPRPGPSLGACIPCQCNGHSNTCDP
ETSICQNCQHHTAGDFCERCAIGYYGTVKGLPNDCRQCACPLITSSNNFSPSCISEGLND
YRCTACPRGYEGQYCERCAFGYTGSPSSPGGSCQECECDPYGSLPVPCDPVTGYCTCRPG
ATGQKCDGCKPGHARDGMECVFCGDECTGLLLSDLARLEQMAVSINLTGPLPAPYKMLYN
FENVTQELKHLLSPQRAPERLLQLAESNLNTLVTEMDELLTRATKVTADGEQTGQDAERT
NMRAKILEGIVKEIVQDAEDVNEKAIKLNETLGAQDKALEKNLQELQQEIDQMMAELRQK
NLDMQNEVAQDELVAAEALLRKVKKLFGESRGKNEELEKELRDKLTDYKSKVDDAQDLLR
EATEKIKEADRLTETNQKNMTTLEKKRQAVESGKQEAENTLKEANDILDEAHHLADEINS
VIDLVKDIQKKLPETSEELKDKTDDLSQKIKNRRLPEKVVQAEDHAAQLNESSAVLDGIL
EEAKNISFNATAAFKAYSNIKDYIDEAERVAKEAKGHANEATQLASGPQSSLKDDAKGSL
QKSFRVLNEAKRLANGVKENDDNLKGMKNRLENANEKNGDLLKGLNDTLGKLSAIPIDTA
AKLQAVKDKARQANATAKDVLAQIKDLNQNLAGLRNNYNKLADDVSKTNAVVKDPAKNKI
IADADATVKNLEQEADRLIDKLKPIKELQDNLKKNISEIKELINQARKQANSIKVSVSSG
GDCIRTYRPEIKKGSYNNIIVNVKTAVADNLLFYLGSAKFTDFLAIEMRKGKVSFLWDVG
SGVGRVEYPDLTIDDSYWYRIEASRTGRNGTISVRALDGPKASIIPSAYNSISPPGYTIL
DVDANAMLFVGGLTGKLKKADAVRVITFTGCMGETYFDSKPIGLWNFRDIEGDCKGCTVS
PQVEDSEGTIQFDGEGYALVSRPIRWYPNISTVIFKFRTFSSSALLMYLATRDLKDFMSV
ELDDGHIKVSYDLGSGIASVISNQNHNDGKWKSFTLSRIQKQANVSIVDIETNQEENIAT
TSSGNNFGLDLKADDKIYFGGLPTLRNLSMKARPEVNLKKYAGCLKDIEISRTPYNILSS
PDYVGVTKGCSLENVYIVSFPKPGFVELPPVSLDVGTEINLSFSTKNESGIILLGSSGTN
NSPRRKRRQTGQAYYAIFLNKGRLEVHLSTGVRTMRKIVVKPELIPFHDGREHSIHVERT
RGMFTVQVDEDRKHMQNLTVEQTITIKKLFVGGSPLTYQPPPLRTIPPFEGCIWNLVINS
IPMDFAQPVSFKNADIGRCIDHKPGEGEVEVTPDQIVFPTDSTLEEDKETTPAFPKFPSP
PPTPILVHGPCAADTEPAFLIGSKQFGLSRNSHIAIAFDDTKVKNSLTIEFEIRTEAESG
LMFYMARINHADFATVQLKNGMAYFSYDLGSGNTSTMIATKINDGQWHKIKISRTKQEGI
LLVDGASNRTTSPKKADILDVVGMLYVGGLPINYTTRRIGPVVYSIDGCMKNLKMTEAPA
DLENPTSSFNVGSCYVNAQKGTYFDGTGFAKAVGAYKVGLDLLVEFEFRTTRTTGVLLGI
SSQKMDGMGIELVDEKLMFHVDNGAGRFTAIYDAGVPGALCDGEWHKVTANKIKHRIELT
VDGHQVGAQSPNTASTSADTNDPVFVGGYPDGLNQFGLTINIPFRGCIRSLKLTKGTSKA
LEINFAKALELKGVQPISCPAN
NT seq 9429 nt   +upstreamnt  +downstreamnt
atgccggggcatgcctggcattttcttctcctgtttttcacaggactagggagtcctgag
agcacccgagcccagcagcagcagcagcagcagcagcagcagcggcccccaacccatctg
ctgccgacacatcagcaaagaggtttatttccagctgtgctgaatctggccacaaatgca
ctcatcaccaccaatgctacctgtggggaccgaggtcctgaaatgtactgcaagttggtg
gaacatgtcccagggcaacctgtgaggaacccccagtgtagaacttgtaatcagaatagc
agctttgcataccagaggcacccaatcacgaatgcaattgatggcaagaacacttggtgg
cagagccccagtattaaaaatggaattgaataccattatgtgaccattacactggattta
cagcaggttttccagattgcatatgtaattgtaaaagcagcaaactcaccacgacctgga
aattggatattggagcgctctttagatggttttgaatataaaccatggcagtaccatgct
atcactgacacagaatgtctaacccgctatggcatttatccacgcactggaccaccatca
tatgcaaaagatgatgaagtgatatgtacttcattttattccaagatccaccccctggaa
aatggagagatccacatatctctaatcaatggaagacccagtgccgatgatccttcccca
gaacttctagaattcacctctgcccgctatatccgcctgagatttcagaggatccgaaca
ctaaatgcagatctgatgatgtttgctcacaaagaccccagggaaatcgaccccattgtt
acaagaaggtattactattcagtaaaggatatttccgtcggagggatgtgcatctgctat
ggtcatgccagggcttgtccacttgatccattaacaaataaatctcgttgtgaatgtgag
cacaatacctgtggtgatagctgtgatcagtgttgtccaggatttcatcaaaaaccttgg
aaagcagggacttttcttaccaagactgaatgtgaagcatgcaattgtcatgggaaggca
gaagaatgctattatgatgaaaatgttgccagcagaaatctgagcttgaatatccatgga
aagtacattggaggtggtgtatgcattaactgtactcaaaacaccacaggcatcaactgc
gagacttgtattgatggcttcttcagacctaaagggatattacccaattatccaagacca
tgccaaccatgctattgtgatccaattggatctttaaatgaaatctgtgttaaggatgag
aaccatgctagacgaggtctgttccctggatcttgccattgcaaacatggctttggagga
gtcagatgtgatcggtgtgctcggggttatactggttatcctgattgtgtgccttgcaat
tgtagtgggataggaagcactaatgaggatccttgtataggaccctgttactgcaaggaa
aatgtcgagggcagagactgcagtcactgcaaagtgggcttcttcaatttacaagagaat
aatcgcaagggctgtgaggaatgcttctgctcaggagtgtcagatagatgtcaaagctcc
cgctggacctatagcagtataaatgatatggatggttggtatcttactgatgtggctggt
ctcctgaggatcacacctcatcaagacagctctggtcaatcccagcaactcagcatcaat
agcttggatgcaaaaagagaactaccacgaatctattactggagtgcacctgaaccatat
ttaggcaacagagtgacagcagctggaggacaattgaaatttactatttcttatgacctc
ataggagaagatgatcttgaaaatgtgctgcaacttatgatcatactagagggaaatggc
ttgcaaatcagcacaacccaggaagaaatctacttgccaccatctaaagaatatactcat
gttgtgttgctcagttcagaattatttaatgtgcatgacactggatctcgaatcagtaga
aaagaatttatgaccatcctagcaaatgtaaagagacttctcatacaagccacatacatc
cttgggatggatgccatcttcaggttgaactctgtaagtcttgaatcagctgtgccatat
cccactgatggagaacttgcagatgcagtagagctttgtcaatgccctccaggatatagt
ggctcctcctgtgagtcttgttggcctgggcacaggcgagttaatggtacaattttcggt
ggcatctgtgagccatgtcaatgctttggtcatgcggaagcatgtgatgacatcacagga
gaatgtgtgggatgcaaagaccatacaggtggtccatattgcaatagatgtcttcctggt
ttctatggggatcctactaaaggaactactgaggactgtcatccttgtgcctgtccatta
aacataccatctaataacttcagtccaacgtgccacttagattggagtcgggaactgata
tgtgatgaatgccctgtcgggtacacaggaccacgctgtgagaggtgtgcagaaggctat
tttggacaaccttctgtacctggaggatcatgtcagccatgccaatgcaatgacaacctt
gacttctccatcccaggaagctgtgacagcttgtctggctcttgtctgatatgtaagcca
ggtacatcaggccgctattgtgagcgctgtgctgacggatattttggagatgcagttgat
gcaaagaactgtcagccatgtcgctgtaatctcaatggctcattctcagagatttgccat
acacagactgggcaatgtgaatgcaaacctaatgttcaaggactccgttgtgatgagtgt
cagcctcaaacctttggcctacaatcttcccagggctgtgttccttgcaattgcaattcc
tttggatccaagtcttttgattgtgaagagagtgggcagtgttggtgccaacctggagta
gcaggaaagaaatgtgaccgatgtgctcatggcttttttaactttcaagagggaggttgc
acttcctgtgagtgtgcccatctgggtaataattgtgatccaaatactggcaaatgtatt
tgtcctcccaatactattggagacaagtgtgataagtgtgcacctaattcttggggccat
agcatcatccatggctgtaaggcttgtaattgcagtttggtgggatcatttgatttccag
tgtaatataaacactggccaatgctcctgccacccagagttctccggcagaaaatgctct
gaatgcaatttgggccattggaattatcctcattgtgatgtgtgtgactgcttcctggct
gggacagatgcctcaacctgcagctcagaaactggaaaatgtgcatgtcttaaccagagt
ggacaatgcacttgtaaggtgaatgtggaaggtgtccactgtgacaggtgccggcctggt
aaatttggacttgatgccaagaacccacttggctgcagcagctgctattgctttggcacg
actacccagtgcactgaagcaaagggactgatccgtatgtgggtaacactgacacctgaa
cagaccatcctcccactagtggatgaagccctccaacacacaaccaccaaaggaattgct
tttcagaacccagaaattgttgcagaaatggaacaagtgagagaggatctccatctggaa
cctttttattggaaacttccagaacaatttgaagggaagaagttgatggcatatggtggc
aagctgaggtatacaatctactttgaagctcgtgaagaaacaggattttttacttataat
ccacaagttataattcgaggtggaacccctgctcatgctagaattatcacccgccatatg
gcagctcccctaattggacaattgacaaggcatgaaatagaaatgacagagaatgaatgg
aaatattatggtgatgacccaaggacaagtagaatggtaacacgtgaggacttcctggat
gtactctatgacattcattatgttcttatcaaggctacgtatggaaatgtcattcggcaa
agcagaatttctgagatatcattggaagtagctgaacaaggagttatatcggcattaagt
ccacgagctcgcttgattgaaaaatgtgactgtcccctgggttattctggcttctcctgt
gaggcttgcatgccaggattttatagattgccttctgaatctggtggcccgagacctgga
ccaagcctgggcgcctgtattccatgtcagtgtaatggacatagcaatacgtgtgacccc
gaaacgtctatatgtcagaactgtcagcatcacactgctggtgacttctgtgaaagatgt
gctattggatactatggaactgtcaagggtctgccaaatgactgtcggcaatgtgcctgc
ccactcatcacttctagcaataattttagcccttcttgcatctcagaaggactcaatgac
tatcgatgtacagcttgcccacgtggatatgaaggccagtactgtgaaagatgtgccttt
ggctatactggcagcccgagcagcccaggaggctcctgccaagaatgtgagtgtgatcca
tatggttcactgcctgtcccctgtgacccagtcactggatattgcacttgccgacccgga
gccacggggcagaagtgtgatggttgcaagcctgggcatgcgcgtgatggcatggagtgt
gttttttgtggtgatgaatgtacaggactccttctcagtgacttggctcgccttgagcag
atggctgttagcatcaaccttactggcccactgcctgcaccatataaaatgctatacaat
tttgaaaatgtgactcaggagctaaagcatttgttgtcacctcagagggcaccagagaga
cttcttcaactggcagagagcaatctgaatacactggtgacagaaatggatgaacttctc
actagagctaccaaggtgacagcagatggcgagcagactgggcaggatgctgagcgaacc
aacatgagagcaaagattctagaaggaatcgttaaggaaattgtccaggatgcagaagat
gtaaatgaaaaagctattaagctaaatgaaactcttggagcccaggacaaagccttagag
aaaaatcttcaagaactacagcaagagattgatcagatgatggcagaattgaggcagaaa
aatctagatatgcaaaatgaagttgcccaggatgagttggtagctgctgaagcccttctg
aggaaagtaaagaagttgtttggagaatctcggggcaaaaatgaagagttggaaaaagag
ctcagggacaaactgactgattataaaagcaaagtagatgatgcccaggatctgttgaga
gaagccactgaaaaaatcaaagaggctgatcgcttaactgaaacaaaccaaaaaaacatg
actactctggagaaaaagagacaagctgttgaaagtggcaaacaagaagctgaaaacaca
ttaaaagaggccaatgacatacttgatgaagcccaccatcttgctgatgaaatcaactct
gtgatagatcttgttaaagacattcagaaaaagttgccagaaacatctgaagaacttaag
gataaaacagatgatctgtcccaaaaaattaaaaatagaagacttccagagaaggtggta
caggctgaagaccatgcagcccagctgaatgaatcatctgcagtgctagatgggatcctt
gaagaagctaaaaacatctccttcaatgctactgcagccttcaaagcttatagcaacatc
aaagattacattgatgaagctgaaagggttgccaaggaagccaaaggtcatgcaaatgaa
gcaacacaactggcatctggtcctcaaagttcattaaaggatgatgccaaaggttctctt
cagaaaagctttagagttcttaatgaagctaaaagactagcaaatggtgttaaagaaaat
gatgataatctgaaaggcatgaaaaacagattggaaaatgctaatgaaaagaatggtgac
ctcctaaaaggtttgaatgatacattgggaaagttatcagcaattccaattgatacagct
gcaaaactgcaagctgttaaagacaaagcaagacaagccaatgctacagcaaaagatgtt
ctggcacagattaaagatctcaaccagaaccttgcaggcctgaggaacaattacaataaa
ctggcagatgatgtgtccaagacaaatgctgtggttaaagaccctgccaagaataaaatt
attgcagatgcagatgctactgttaaaaatcttgagcaagaagctgatcgattaatagat
aaactcaagcccatcaaggagcttcaggataatctgaaaaaaaatatctctgagataaag
gaactgataaaccaggcccggaaacaagccaattctatcaaagtgtctgtgtcttctgga
ggtgactgcattcgaacatataggccagaaatcaagaaaggaagctacaataatatcatt
gtcaatgtgaagacagctgtggctgataatctccttttttatcttggcagtgccaagttt
actgattttctggccatagaaatgcgaaaggggaaagtgagtttcctctgggatgttggt
tctggagttggacgagttgaatatccagatttgaccatcgatgactcctactggtatcga
attgaagcatcaagaactgggaggaatggaactatttctgttagagcactggatggaccg
aaagccagcatcataccaagtgcatacaattcaatctctcccccgggctacacaattcta
gatgtggatgcaaatgcaatgctctttgttggtggtttgactgggaaattaaagaaggct
gatgctgtacgagtcattaccttcactggatgtatgggtgaaacatactttgacagcaaa
cctataggattgtggaatttccgagatatagaaggagactgtaaaggatgcacagtcagc
ccgcaggtagaagacagtgaaggtactatccagtttgatggagaaggctatgctttggtc
agccgccctatacgctggtatcccaatatctctacagtcatattcaagttcaggaccttt
tcttcaagtgctcttctgatgtatcttgccacccgagacctgaaagattttatgagtgta
gaactcgatgatggacacataaaagtcagctatgatctgggttcaggcattgcttctgtt
atcagcaaccaaaaccacaacgatggaaaatggaaatccttcaccctgtcaagaattcaa
aaacaagccaacgtctctattgtggacattgagactaaccaggaggagaacatagcaaca
acatcttcaggaaataattttggccttgacttgaaagcagatgacaagatatattttggt
ggcttgccaaccctgagaaacctgagtatgaaagccaggcctgaagtaaacttgaagaaa
tacgctggatgcctcaaggatattgaaatttcacgaacaccatataacatactcagtagt
cctgattatgttggagtgaccaaaggatgttcccttgagaatgtttacattgttagtttt
cccaagcctggatttgtagagctcccaccagtgtcacttgacgttggcacagaaatcaac
ctttccttcagcaccaaaaatgagtctgggatcattcttctaggaagcagtggaactaat
aactcaccaaggagaaaacgcagacagactggacaggcctattatgctatattcctgaat
aaaggccgtctggaagtacatctctccactggagtgaggaccatgcgcaagattgttgtc
aagccagagctaatcccatttcatgatggtagagaacattccattcatgtggaaagaaca
agaggaatgtttactgttcaagtggatgaagacagaaagcatatgcagaacctgacagtg
gaacaaactattaccattaaaaaactctttgtaggaggctctccattgacataccaacct
cctccactcagaaccatacctccttttgaaggctgtatatggaatcttgttataaattcc
atcccaatggactttgctcaacctgtgtccttcaaaaatgcagacattggtcgatgtata
gatcacaaacctggtgaaggagaggttgaagttactccagaccaaatagttttcccaact
gattctacccttgaagaagataaagagactacaccagcctttccaaaattcccctctcca
ccgcctacacctattcttgttcatggaccctgtgctgcagatacagaaccagcatttttg
ataggaagcaaacagtttggactttcaagaaacagccatattgcaattgcttttgatgac
accaaagttaaaaacagcctcacaattgaatttgaaatacgaactgaagctgaatcaggt
ttgatgttttacatggctcggatcaatcatgctgattttgctacagtccaactgaaaaat
ggcatggcctacttcagctatgatcttggaagtggtaacacaagtactatgattgccacc
aaaatcaacgatggtcagtggcacaagattaagatctcccgaaccaagcaagaaggaata
ttacttgtagatggtgcttcgaacaggacaaccagccccaagaaagccgatatcctagat
gtagtggggatgctgtatgttggagggctgcccatcaactatacaacaagaagaattggt
ccagttgtctacagtattgatggctgcatgaagaatcttaaaatgacagaggctcctgca
gaccttgaaaatccaacctctagcttcaatgttggctcatgttatgtaaatgctcaaaaa
ggaacatattttgatggaacaggctttgccaaagcagttggagcttacaaagtaggattg
gatcttcttgtggagtttgaatttcgtacaactagaaccactggtgtcctcttgggaatc
agcagccaaaaaatggatggcatgggcattgaactggtagatgaaaaactcatgttccat
gtggataatggtgctggccggttcactgctatttatgatgctggtgtccctggagctttg
tgtgatggggagtggcataaggtgactgcaaacaaaatcaaacaccgaatagagttgaca
gtggatggacatcaggtgggagctcagagtccaaacactgcatctacatcagctgataca
aatgatcctgtctttgttggagggtacccagatggcctcaatcagtttggtcttacaatc
aatatcccattcagaggatgcatccgctcactgaagctcactaaaggcacttccaaagct
ctggaaattaactttgcaaaagccttggagctaaagggtgttcaacctatatcttgtcct
gccaactaa

KEGG   Sarcophilus harrisii (Tasmanian devil): 100924531
Entry
100924531         CDS       T02286                                 

Gene name
LAMA5
Definition
(RefSeq) laminin subunit alpha-5
  KO
K06240  laminin, alpha 3/5
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr04151  PI3K-Akt signaling pathway
shr04510  Focal adhesion
shr04512  ECM-receptor interaction
shr05145  Toxoplasmosis
shr05146  Amoebiasis
shr05165  Human papillomavirus infection
shr05200  Pathways in cancer
shr05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:shr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100924531 (LAMA5)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100924531 (LAMA5)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100924531 (LAMA5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100924531 (LAMA5)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100924531 (LAMA5)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100924531 (LAMA5)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100924531 (LAMA5)
   05145 Toxoplasmosis
    100924531 (LAMA5)
SSDB
Motif
Pfam: Laminin_EGF Laminin_N Laminin_G_2 Laminin_I Laminin_G_1 Laminin_II Laminin_B Laminin_G_3
Other DBs
NCBI-GeneID: 100924531
NCBI-ProteinID: XP_031807581
LinkDB
Position
2
AA seq 3706 aa
MARWGAGHGRGDASLCALPLLLPLLLFLRGVTGAPETGGESRSSWGGGASGGFSLHPPYF
NLAEGTRISASATCGEEAPAGARGPPRPTEDLYCKLVGGPVAGGDPNQTIQGQYCDICTS
ANINKAHPISNAVDGTERWWQSPPLSRGLEYSEVNVTLDLGQLFHVAYVLIKFANSPRPD
LWVLERSTDFGLTYQPWQYFASSKRDCIEKFGLRTLERITQDDDVICTTEYSRIVPLENG
EIVVSLVNGRPGAMNFSYSPLLRNFTKATNIRLRFLRTNTLLGHLMGKALRDPTVTRRYY
YSIKDISIGGRCVCNGHADVCDAQDPTDPYRLQCACQHNTCGGACDRCCPGFHQLPWKPA
TMDNANECQSCNCHGHAHDCYYDPEVDRHRASKNRDNVYEGGGVCIDCQHHTTGINCERC
VPGYYRSPEHPIDSPYVCYRCNCESDFTDGTCEDLTGRCYCKPNYTGERCDACAKGFTDF
PHCYPVPSFSHNDTGEQVLPAGQIVNCDCSAAGTLGNACRKDPHIGQCVCKPNFQGVHCE
QCAPGFFGPGCLPCQCSGPGQTGSSCDNETGQCVCRTGFEGPACDRCAPGYFSYPLCQLC
GCSPAGTLPEACDESGRCFCRPEFDGPHCDRCQAGYHSYPHCRVCSCDPRGSLDELCSGA
GMCHCRPGYAGSACQECAPGYYGFPNCVACQCSEAGSLHITCEPETGQCNCRPRVTGLHC
DTCVPGTYGFPHCEVGSCDPAGQVSVSSSPAEGSCECRAHVEGPRCDRCKPLYWNLSPTN
PYGCSSCSCDPRGTISGVAECQQGNGQCFCKPNVCGQKCTSCKDGYFRLDQADYFGCKTC
QCDIGGALAQGCEPRMGTCQCRPNTQGPTCNKPAKDHYLPDLHHIRFELEEGSTPDGRPV
RFGYNPLEFENFSWRGYAQMTPVQPKVVVKLNVTSPDLFHLVFRYVNRGSTSVNGKVSVL
EEGKFNTCSNCTEQTHLVVFAPSTEPVFLTVPQSSYGEPFVLNPSIWSLVIEAEGVLLDY
VVLLPSAYYEAPILQVKVTEACTYSPKPEQVRSNCLLYTYLPLDGFPFAGGTDAVCRLDN
SLPKACQMEQPSSSHPPLATCWGNDVDVQVQIVMPQPGQYALVVEYANENDLQGVSVAVH
TPQWTPQQGLLTLYPCQYSFLCRGTALDSQNRLVAFEVTGETSIRLTAEHAQFLLYRIYL
VPMSKFTTEFVEPKVHCISNHGTFGLSSGSCLPSRFQKLSQPIVLTECKVLPVPPDFPLS
HMHTVTPAGPPLSPQPHPPTAADPTIEPTLLQSPQSTVVFSTHIPTLGRYAFLLHSYQPN
LPTFPVEVLINGGRVWHGQANATFCPHAYGCRSLVVCEGQIVLDVTDNELTVTVRVPEGQ
QLWLDYVLVVPEDGYSSNYLQEEPLDKSYDFISLCATNGFYISPASSPPFCRDAAISLSL
FYNNGAQPCRCHEVGATGPTCEPFGGQCPCRAHVIGRDCSRCATGYWGFPNCRPCDCGSR
LCDEASGQCICPPRTIPPDCVVCQPQTFGCHPLVGCEDCNCSRPGVKDFSDPGCDLDSGQ
CRCKPNVVGRRCDTCAPGFYGYPSCQRCQCHEAGTVAGVCDPVTGQCHCKDNVEGGRCDQ
CRLGTFSLDASNPKGCTRCFCFGATDRCRSSQQVRGEFIDMRGWVLVSGERQQVPTSLRV
DAGLVHADLRNVPEAFQDLYWQAPASYLGDRVSSYGGSLRYELHSETQRGDVFVPTESRP
DVILKGNQMSITFLESSYPAPGDIHRGKVDLVEGNFRHTETNNPVSREELMMVLAGLEQL
HIRALFSQISSAVSLQRVVLEVVMDGPGGAQASNVEVCMCPANYRGDSCQECAPGYYRDT
KGHFLGKCIPCHCNGHSDRCLPGSGICVGCQHNTEGDHCERCKDGFVSNATQDQSSSFCI
SCPCPLSVPSNNFAVGCVHKGGVTQCLCQPGYAGTSCERCAPGYYGNPLVIGSSCQPCDC
SGNGDPNMLFSHCDPLTGACLGCMYHTAGPHCESCAPGYYGNALLPRNCTKCDCSPCGTE
VCDARTGQCRCKAGVTGQRCDRCQDGHYGFDSCGGCQPCNCGLGAVGSSCHSQSGQCHCR
AGVSGTQCQQCAPGYWGFNEHGCTRCQCQGGHCDPRTGECTCPPGLSGKQCDSCSHQHQV
PVTHSPGGVHCEVCDSCVVLLLDDLERMESLFPTIRQQLSSLNASSVAWARLHEINSSIA
ALTNQLRGPPGSREPTRQRLDELERQSGALEEETSTLHSRVSEVRAQAGQLQESSGDNLQ
RAETLLQSLQNLERALGELKSQMDRLSPSNTSTASGEEFLQTLAEVEQMLQEMRDRDFGG
PRNVAEGELGEAQRLLNRVQSQLTSQWEESQTLASSIRERLAQHSSQLMDLRDALNEAVN
KTRLTEELNSRNQEHLEERLQKKKELERENATLRDTLRMAEDALAQVSELLQTMDRAKEE
YERLAANLDGARTPLTEKMQKFSPASSKIPLVERAEEHARELDQLAYNLSSIIRSTNQDR
FIQRAIEASNAYGSILQAVRQAEEAAGQALHNATSTWEMVVQEGLSARARELRENSSILE
EAVRDQQRRLNGAIRETLQASRTQLEEAKAKKDHLVAQLKGVQSMLAMDKDDTSEKIARA
KAVAMEANDTATQVGATLRDMQKNLHQWQGQYGDLRSQDLAQAMEDAGKSVSSLEKTLPQ
LLAKLSQLENKRGQNASLALSNSILRVRELITQARSAASKVKVPMKFNGRSGVQLRPPRD
LQDLAAYTALKFYIQSSEPPQQQGHNGGSQFILYMGSREASGDYMGVILHEHKVQWVYRL
GEAAHRTLTIDEDIGEHFATVSIDRILQYGHMSVTMEKQMVHETKGDSVYPGDQGLLNLR
AQDFVFYVGGYPSNFTPPRPLRYPGYRGCIEMDTLNEEVVSLYNFQKTFHLDTAVDKPCA
RSKSTGDPWLTDGSYLDGTGFAHIHFESQLISTKRFEQELRLVSYNGIIFFLQYQDQFLC
LAVQEGHLILYYDFSHGLKVATPQQELTPLTSSNKAIQIFIMGVTGRKRILVRVERVSVF
SLQEDNLLENADSYYLGGVPLARLPPSLRSLFPTGGSIRGCVKGLKALGKYVDLKRLNTT
GISSGCTSDLLITRSMTFHGHGYLTLALRDVPPLTGNFYTGFGFRSTQDSGLLYYHASPE
GIFQVFLRQGRVTLKLLRMEVMTRDAYADGVSHYVAVYSNSTGVWLYVDDRLQVTEPQGG
RSRRQAPAEDPPRFLLGGLPESPAFQNLTGCISNVFVRRVSEAQHVVDLQQNIQNINVTT
GCALPDEPLQLRVSPRKFRRKPKAALHDQEMPPDFACQFPTHPQTISHAYQFGASPASRL
EFAPLPFSFQERTHFSMDIQLRSLRGLLLAVPAAKSGSPFLALFLSHGHFILQAGGHGKP
FRVRSREQYKPGGWHTVFFSREQNRIQLVIDGLRAQSSERSRARGKALLGHGPVYVGGLP
SGPSWTHLPEAAGTGFKGCIRNLKMNGQPLETPTQLHGVIPCYTGTLEKGLFFAAQGGSV
VLEHPTTWGPDLELVLEVRPRAAVGLLFHLGSTQGPPYIRLEADGDKVLVRADSGAGEFS
TSVTRPPLCDGLWHRIAVIKGRSMLRLDVDTKGNYTVAPASVPSIITKEPLYLGGLPETL
KSTVSPSSLPGYYGCIRNLVANRRPVDLTRTGIIQGSVGANGCPVM
NT seq 11121 nt   +upstreamnt  +downstreamnt
atggcgaggtggggagctgggcacggccgaggggacgcgtctctctgcgcgctgcccctg
ctgctgcctctgctgctgtttctccgcggcgtgactggggcacccgagactggtggcgaa
agtagaagcagctggggtgggggggccagcggaggcttcagcctgcacccaccctacttc
aacctggccgagggcacccgcatctccgcttctgcgacctgcggcgaggaggcgccggcc
ggagcgcggggccccccgaggcccaccgaggacctttactgcaagctagtaggggggccg
gtggccggcggcgaccccaaccagaccattcagggccaatactgcgatatctgcacatca
gccaacatcaacaaggctcaccctatctccaatgcagtggatggaacagaacgatggtgg
cagagccctccactctcccggggtttggagtacagtgaagtcaatgtcaccctcgacctg
ggccagctttttcacgtggcctatgtcctcatcaagtttgccaattccccacggccagac
ctctgggtacttgagagatccacagattttggactgacctaccaaccgtggcagtacttt
gcctcatccaagagggactgcatcgagaagtttgggcttcggacgctggagcggatcact
caggatgatgatgtcatctgtaccactgagtactctcgcattgtacccctagaaaatgga
gagatcgtggtgtctctggtgaatgggcggccgggggccatgaatttctcatactcccca
ctccttcggaatttcaccaaggccaccaacatccgccttcgttttctacgcaccaatact
ctccttggccacctgatggggaaagcgctgcgagaccccacagtcactcgccggtattac
tacagcatcaaggacatcagcattggcgggcgttgtgtctgcaatggtcacgcggacgtc
tgcgatgcccaagaccccacagacccttacaggctccagtgcgcctgtcagcacaacacc
tgcgggggtgcctgcgaccgctgctgccccggcttccaccagctgccctggaaaccagcc
acaatggacaatgcaaacgagtgtcagtcctgtaactgtcatgggcatgcacacgactgc
tactatgacccagaggtggatcggcacagagctagcaagaaccgggacaacgtctacgaa
ggtggcggcgtctgcattgactgccagcaccacaccaccggcatcaactgtgagcgctgc
gtccccggttactatcggtcgcccgagcaccccatcgattctccctacgtctgctaccgt
tgcaactgtgagtcagacttcactgatgggacgtgcgaggacctgaccggccgctgttac
tgcaaacccaactacacaggggagcggtgtgatgcctgcgccaaagggttcacagacttc
ccccactgctaccctgtgccctcattctcccacaatgatactggggaacaggtgcttcca
gctgggcagatcgtgaactgtgactgcagcgccgccgggaccctgggaaacgcctgccgc
aaagacccgcacattggccagtgtgtgtgcaagcccaacttccagggtgtgcactgtgaa
cagtgtgccccaggcttctttggcccaggctgcctgccctgccagtgctctgggcctggc
cagactggcagcagctgtgacaacgagacaggacagtgtgtgtgccgtactggcttcgaa
ggccccgcctgtgaccgctgtgcccccggctacttcagctacccactctgccaactgtgc
ggctgcagccctgcggggactctgccggaggcctgtgacgagtctgggaggtgcttctgc
cgccccgagtttgatggaccgcactgtgaccgctgccaagctggctaccactcgtacccc
cactgccgagtttgctcctgtgaccctcgcggctccttggacgagttgtgcagcggggct
ggaatgtgtcactgtcggccaggctatgcagggtctgcttgccaggaatgtgcccctggt
tattatggattccccaactgtgttgcttgtcagtgctctgaagctgggtccctccacatc
acctgtgagcctgagactgggcagtgcaactgccggccacgagtgactggtctgcattgt
gacacgtgtgtgccagggacttacggattcccccactgtgaagttggctcctgcgatcca
gccggtcaggtctcagtcagctcctcacccgctgagggttcctgtgagtgtcgggctcat
gtggagggtcccaggtgtgataggtgcaagcctctctattggaatctgagcccaactaac
ccctatggctgcagcagctgtagctgtgaccctcgaggtaccatcagtggagtggctgaa
tgtcagcagggcaacggacagtgcttctgcaaacccaacgtctgtggtcagaagtgtacc
tcctgcaaggacggctacttcagactggaccaagcagactacttcggctgtaagacctgt
cagtgtgacatcgggggagccctggcccagggttgtgagccaaggatggggacctgtcag
tgccggcccaacacacaggggcccacatgcaacaagcctgcaaaagaccattacctccca
gatctgcaccatatcaggtttgagctggaggagggctccacacctgatggccggcccgtg
cgttttggctacaaccccttggagtttgagaatttcagctggaggggttatgcccagatg
actcccgttcagcccaaagtagtggtgaaactcaacgtgacgtctcctgacctattccat
cttgtcttccgctatgtcaaccgggggtccacaagtgtgaacgggaaggtttcagtcctt
gaggaagggaaatttaacacttgcagcaactgcacagagcagacccacctggtcgtattt
gcacccagcacggagcctgtgtttcttactgtgccccagagcagctacggggagcccttt
gtcctgaaccccagtatctggtccctggtaattgaggctgaaggtgtcctgctggactat
gtggtcttgcttcccagtgcatattatgaagcccccatactgcaggtgaaggtgactgag
gcctgtacttacagccccaaacctgagcaagtcaggagcaactgcctcctatacacctac
ctcccactagacggcttcccctttgccggagggaccgatgctgtttgccgcctagacaat
agtctacccaaggcctgtcagatggagcagcctagttcgtctcacccacctctggccact
tgctggggcaatgatgtggatgtccaagtgcaaattgtcatgccccagcctggccaatat
gcccttgtagtggagtacgccaatgagaacgatcttcagggtgtgagcgtggctgtgcac
actccccagtggaccccccaacaaggactgctcaccctctacccctgccagtatagtttc
ctgtgccggggtactgccttagattcccagaatcgccttgtggcttttgaagtaactggc
gagactagcatccggctcacggcagaacacgcacagttcttactgtaccgcatttacctt
gtccccatgagcaagttcaccacggagtttgtggaacccaaagttcactgcatcagtaac
cacgggacctttggactgagcagtggttcctgcctcccttcgcgcttccagaagctgtcc
cagcccattgtattaacagagtgcaaggttctgcccgtgccgcctgacttccccttgagc
cacatgcacacggtcactcctgccggacccccgctgagtcctcagcctcacccacccaca
gctgcggaccccaccattgagcccaccctcttgcagtctccgcagagcactgtcgtgttt
agcactcacatcccgacactggggcgttacgccttcctgctccatagctaccaacccaac
ctccccactttccctgtggaagtgctcatcaatggtggccgggtctggcacggccaggcc
aatgccactttctgcccccacgcttacggctgccgcagcctggttgtgtgcgagggtcag
atcgtcctggatgtgacggacaacgagctgaccgtgacggtccgtgtgcctgagggtcag
cagctgtggctggactatgtgctcgttgtccctgaggatggctacagctccaactacctc
caagaggagcctctggacaagtcctatgattttatcagtctttgtgcaaccaatggcttt
tacatcagccctgccagctcacctccgttctgccgggatgccgccatctccttgtccctc
ttctataacaatggggcccagccctgccgttgccacgaagtaggagctacgggccccacc
tgcgagccctttgggggccagtgcccctgtcgagcccacgtcatcggccgcgactgctcc
cgctgcgccaccggttactggggcttcccgaattgcaggccctgtgactgtgggagccgc
ctctgcgacgaagcttctggccagtgcatctgcccaccccgcaccatcccgcccgactgt
gtggtctgccaaccccagacgttcggctgccaccccctggtgggctgtgaggactgcaac
tgctcgcgccccggtgtcaaggacttctcggaccctggctgcgacctggacagcgggcag
tgcaggtgcaagcccaatgtcgtcggccgccgctgtgacacgtgtgctcctggcttctac
ggctatcccagctgccagcggtgccagtgccatgaggcaggcacagtggccggagtctgt
gaccctgtcactggtcagtgccattgtaaggacaacgtggagggtggacgctgtgaccag
tgccgcctgggcaccttttcgctggatgcttccaaccccaagggctgcacgcgctgtttt
tgctttggggccactgaccggtgccggagctcccagcaagtccgtggggagttcatagac
atgcgagggtgggtgctggtgagtggggagcggcagcaggtgccaacttcgctccgcgtg
gatgctgggctggtccacgctgacctgcgcaatgttcccgaggcgtttcaggacctgtac
tggcaggcgcctgcctcctacctgggggaccgggtgtcatcttatggggggagcctgcgc
tacgagctgcattcggagacccagcggggggatgtctttgtccctaccgagagccggcca
gatgtgatcctgaagggaaaccagatgagtatcactttcctagagagttcctacccggct
cctggggacattcatcgaggaaaggtggatctggtggagggcaacttccgccacacagag
actaacaaccccgtctcccgggaggagctcatgatggtgctggctggcctggagcagctg
catatccgcgccctcttctctcagatctcctcggccgtctcccttcagagggtggtgctg
gaggtggtgatggacgggcctgggggagcccaggccagcaatgtggaggtctgcatgtgt
cccgccaactaccgcggggactcctgccaggaatgtgctcctggctattaccgagacacc
aagggccacttcctgggcaaatgcattccctgccactgcaatggtcactcagaccgatgc
ctcccgggctcaggcatctgtgtgggttgccaacacaacactgagggtgaccactgtgaa
cggtgcaaagatggcttcgtgagcaatgcaactcaagatcaatcatcttccttctgcatc
agttgcccctgccctctctctgtgccttccaacaactttgcagttggatgtgtccataag
ggtggagtcactcagtgtctctgccagcctgggtacgctggaacttcttgtgagcggtgt
gctcctggatactatggcaaccccttggtgattggcagctcctgccagccttgtgactgc
agtgggaacggtgaccctaacatgctgttcagtcattgtgatccactgactggggcgtgc
ttggggtgcatgtaccatacagctggcccccactgtgagagctgtgctcctggttactat
ggcaacgctctgctccccaggaactgtacaaagtgtgactgctcaccctgtgggacagag
gtgtgcgatgctagaacggggcagtgtcggtgcaaggccggggtgactggtcagcgttgt
gatcgctgtcaggatggacactatggctttgacagttgtggaggctgccagccctgtaac
tgtggtctgggtgcagttgggtccagctgccactcccagagtggtcagtgccattgccgg
gcaggggtcagtggaacacagtgccagcagtgtgcccctggctactgggggttcaatgag
catggctgtacccgctgccagtgccagggaggccactgtgatccccgcacgggcgagtgc
acctgcccccccggcctaagtgggaaacagtgcgactcctgcagccaccagcatcaagtt
cctgtgacccacagccctgggggcgtccactgtgaagtgtgtgacagctgtgtggtgctg
ctgctggatgacctggagcggatggagtccctcttccccaccatccgccagcagctcagc
agcctcaatgccagctccgtggcctgggcccgactgcacgagatcaacagctccattgct
gccctgacgaatcagctccggggcccgccggggtctcgggagccaacaagacagaggcta
gatgagctggagcgtcagagtggagctctggaggaagagaccagcacgcttcacagcagg
gtgtcagaggttcgagcccaggcgggtcagctacaggagagctctggggacaacctgcag
cgggcagagaccctgctccagagcctccagaacctggagcgtgctctaggggagctgaaa
tctcagatggacagactctccccatctaacaccagcacagcctctggtgaagagttcctt
cagacactggcggaagtggaacaaatgctgcaggagatgcgagacagggattttgggggg
ccacggaatgtggctgaaggggagctgggagaagcacagagattactaaaccgagtgcaa
agtcaactaaccagccaatgggaagaaagtcagacgttggcatcaagtatccgggagcgg
ttggctcagcacagttcgcagctcatggatctccgggatgccttgaatgaggccgtcaat
aagactcgtctcactgaagagctcaacagtcggaaccaagaacacctggaagagaggctg
caaaagaaaaaggagttggagagagagaatgcaacactgagggatactctgcgcatggct
gaggatgccttagctcaagtttctgaacttttgcagaccatggacagggccaaagaggag
tacgagcgtctggctgccaacctggatggtgcccgaacccccttgacggagaagatgcag
aagttttctcctgcaagcagcaagattcctctcgtggagcgggctgaggagcatgcccga
gagctcgaccagctggcatacaacctctccagcatcattcgcagcacaaaccaggatcgg
tttattcagcgagcaattgaagcctccaatgcttatggcagcatcctccaggcagtgagg
caggccgaggaggccgccggccaggccctgcacaatgcaaccagtacttgggagatggtc
gttcaggaaggcctgagtgcccgcgcccgggagctccgggagaacagcagcatcctggaa
gaagctgtccgtgaccaacagaggagattgaacggagccattagagaaaccttgcaagcc
tctcggactcaactggaagaagccaaagctaagaaggatcatctagttgcccagctgaag
ggtgtacagagcatgctagccatggacaaagatgatacaagtgagaaaatcgcccgggcc
aaggcagtggccatggaagccaatgacacagccacacaggtgggggccacattgagggac
atgcagaagaacctgcatcaatggcagggacagtacggggacctgagaagccaagacctg
gcccaggctatggaagatgctgggaaatcagtgtccagtctggagaagactctgcctcaa
ctactggccaagctaagccagctggagaacaagagaggccagaacgccagcttggccctc
tccaacagcatcttgcgggtgcgggagctcatcacccaggcccgcagtgctgcaagcaag
gtgaaagtgcccatgaaattcaacggccgctcgggagtgcagctgcgaccgccccgggac
ctacaggacctggctgcgtacacagcactcaagttctatatccagagctcagagcctcct
cagcagcagggccacaatggcggcagccagtttatcctctatatgggcagtcgcgaggct
tctggggactacatgggagtgatcctgcatgagcacaaggtgcagtgggtttaccggctc
ggggaggcggcccacaggaccctgaccatcgatgaggacattggagagcattttgctact
gtcagcattgacaggattcttcagtatggtcacatgtctgtcacaatggagaagcagatg
gtacatgagaccaagggagatagtgtgtatcctggggatcaaggtctactcaacctgaga
gcccaagactttgtcttctatgtgggaggctacccttctaacttcacacctcccaggcct
ttgcgttaccctggttaccggggctgcattgagatggacactctgaatgaggaggttgtc
agtctttacaacttccagaagactttccatctggacacggccgtggacaaaccctgtgcc
agatccaagtccacgggagacccctggctgacagatggctcctacctggatggcacgggc
tttgcacatatccattttgagagtcagctcatcagcaccaagcgctttgagcaggagttg
agactggtctcctataatggtatcatcttcttccttcagtaccaggaccagttcctatgt
ctggctgtccaggaaggacacctcatcctctactacgatttcagccatggactgaaggtt
gccaccccccaacaggagctgacaccccttacctcgtccaacaaagcgatccagattttc
atcatgggtgtgactggccgaaagcggattctggtccgagtggagcgagtatctgtcttc
agcttgcaggaggataatttgctggagaatgccgactcctattacctgggaggagttcct
ctggcccggcttcccccgagcctcaggtccttgttccctactgggggatcaatccgaggc
tgtgtgaagggcctgaaagcccttggcaaatatgtggacctgaagagactgaatacaacg
ggcatcagctcaggctgcacttctgacctcctgattacacggtccatgaccttccacggg
catggctacctgaccttggccctcagagatgtgccccctcttactggaaacttctacacg
ggctttggcttccgttccacacaggacagcggtcttctctactatcacgcctccccggag
ggcattttccaggtgttcctgagacagggtcgagtgactctcaagctccttcggatggag
gtcatgacaagagatgcttatgctgacggggtctcacactatgttgcagtctacagtaac
agcacaggcgtctggctgtacgtggatgaccgcctccaagtcacagagcctcaagggggt
cgatctcgtcgtcaggccccagccgaggaccctcctcgcttcctcctgggggggctgccc
gagtcccctgccttccaaaacctaactggctgtatcagcaacgtctttgtccggcgggta
tccgaggcccaacacgttgtcgacctgcagcagaacatccagaatatcaacgtgaccaca
ggctgtgcccttccggatgagcctctccagctcagggtctccccaaggaagttccgaagg
aaacccaaggctgctctccatgaccaagagatgcccccagactttgcttgccaattcccc
acccatccccaaaccatcagccacgcctaccaatttggggcttctcctgccagccgtctg
gagtttgctcccctcccattctctttccaggaacggactcacttctctatggacatccag
cttcgctcactccgtggactgcttctggctgtgcccgctgccaagtcgggaagccccttc
ctggccctcttcctcagtcatggccacttcatcctccaggctggaggccatgggaaacct
tttagagtccgcagccgcgagcagtacaagccaggaggctggcacacggtctttttcagc
cgagagcagaatcgaattcagctggtgatcgacggtcttcgggctcagagcagtgagagg
tctcgtgcccgtggaaaggccctgctgggccacggacctgtctacgtgggcggcctcccc
tctggccccagctggactcatctcccagaagcagctggcactggctttaaaggctgcata
agaaacctgaagatgaatgggcagcctttggagactcccacgcagctccatggagtgata
ccgtgctacactgggaccctagagaaagggctgttctttgctgcacagggcggaagtgtt
gtattagagcaccccacaacctgggggccagacctggagctggtgttagaggtgcgtccg
agggcagcagtgggacttctctttcacctagggtccacgcagggaccaccctatatcaga
cttgaagcggatggagacaaggtgcttgtcagggccgacagcggggccggggagttctcc
acgtcagtgacacggcctcctctctgtgatggactgtggcaccgtatcgcagtgattaaa
ggaagaagcatgctccggcttgatgtggatacaaaaggcaattacacagtggctcctgcc
tcagttccttccattatcaccaaagaacctctttacttgggaggtctgccagagactttg
aagagcacggtttcaccatcatctctacctggttactatggctgtataaggaatcttgtg
gcaaaccgtcgtccagttgacttgacacgcactggcatcatacaagggtcagtgggtgca
aatggctgcccagtcatgtaa

KEGG   Sarcophilus harrisii (Tasmanian devil): 100925578
Entry
100925578         CDS       T02286                                 

Gene name
LAMA1
Definition
(RefSeq) laminin subunit alpha-1
  KO
K05637  laminin, alpha 1/2
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr04151  PI3K-Akt signaling pathway
shr04510  Focal adhesion
shr04512  ECM-receptor interaction
shr05145  Toxoplasmosis
shr05146  Amoebiasis
shr05165  Human papillomavirus infection
shr05200  Pathways in cancer
shr05222  Small cell lung cancer
shr05410  Hypertrophic cardiomyopathy
shr05412  Arrhythmogenic right ventricular cardiomyopathy
shr05414  Dilated cardiomyopathy
shr05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:shr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100925578 (LAMA1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100925578 (LAMA1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100925578 (LAMA1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100925578 (LAMA1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100925578 (LAMA1)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100925578 (LAMA1)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100925578 (LAMA1)
   05414 Dilated cardiomyopathy
    100925578 (LAMA1)
   05416 Viral myocarditis
    100925578 (LAMA1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100925578 (LAMA1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100925578 (LAMA1)
   05145 Toxoplasmosis
    100925578 (LAMA1)
SSDB
Motif
Pfam: Laminin_G_1 Laminin_EGF Laminin_G_2 Laminin_N Laminin_B Laminin_I Laminin_II Laminin_G_3 DUF1080
Other DBs
NCBI-GeneID: 100925578
NCBI-ProteinID: XP_012396990
Ensembl: ENSSHAG00000009924
LinkDB
Position
1
AA seq 3084 aa
MLRCCVRGLLVAVLLLWNAGQCQQRGLFPAILNLASNAHINTNATCGEKGPEMFCKLVEH
VPGRPIKNAQCRICDNNSASPKERHPISNAIDGTNNWWQSPSIQNGREFHWVTITLDLRQ
VFQVAYIIIKAANSPRPGNWILERSLDGKKFTPWQYYAISDTECLTRYNITPRLGPPTYK
RDDEVICTSYYSRLVPLEHGEIHTSLINGRPSADDLSPKLLEFTSARYIRLRLQRIRTLN
ADLMTLSHRDPKDLDPIVTRRYYYSIKDISIGGMCICYGHASSCPWDETTKKLQCQCEHN
TCGESCNECCPGFHQQPWRPGTISSGNTCEECNCHNKTKDCYYDQSVADRKKSMNTAGHF
KGGGVCVNCLQNTAGINCETCIDGYYRPHKVSPYENNPCLPCNCDPFGSLNSVCIKDDRQ
SDQLNGNWPGQCQCREGYTGEKCDRCQFGYKGYPNCFRCNCSLAGSVNDDPCTEPCLCKE
NVEGEECDRCKPGFYNLKERNPEGCTECFCFGVSDVCDSLSWPVSQVTDMSGWLVTDLVS
SNNVQSQQNQVDEPHQITINNTVAMQMLKSKYYWSAPPAYLGNKLTAFGGNLKYTVSYDI
PMETVDSDLMSHADVIIKGNGLTLSTRAEGLSLQPYEEYFNVVKLVPENFRDYNTKREID
RDQLMTVLANVTHLLIRANYNTAKKALYRLDAVTLDTANPNVIDLVLATDAEHCECPQGY
TGISCESCLPGYYRVGGILFGGICQPCECHSHATECDIHGVCLTCKHNTAGAHCDQCSPG
FYGNPSRGTSEDCQRCACPLTTASNNFSPTCHLDDGDEVICDQCQPGYTGMWCERCADGY
YGNPTVPGETCVPCDCNSNVDPLEVDHCDTVTGECLKCIGNTEGPHCERCAEGFYGDALV
AKNCRACSCHGSSSLSSVCHHETGLCKCKPNVMGQHCDQCLDGFYGLNTGLGCLPCNCSQ
LGSVSENCSDEGQCYCVPGVAGQRCDRCAHGFYAYQDGSCTPCNCPHTQNTCDPESGECI
CPPHSQGLKCESCEDGYWGRDPELGCKACNCSSIGSTSHQCDLSTGQCSCREKYGGQSCN
ECALGFRDYPDCVSCDCEISGTKGETCDEKQGVCSCEEESGTCFCKENVFGLHCSECKTG
TFALHSDNPLGCSPCFCFGMTRFCSELEGYVRIPITLTPDQSILRVVSQSNLEGTIEGVY
YQHPEILLDAVAVRQHVNSEPFYWRLPDQFLGDQLMAYGGKLKYTVAFYSSDGIGTYNLE
PQILIKGGRTSKLVIYMNIPAPENGVRKEQEVDMKENIWKYFNSVSEKPVTHSDFMSVLS
NIDYILIKASYGQGLLQSRIANISMEIGVKAEEMHSKREVAYLLENCDCPPGYAGLSCQD
CAPGYHRAKLPEVSVRESRPLIAPCVPCHCNNHTETCHPETGKCLNCRDNTVGDHCNVCA
PGYYGKVLGFTSDCSLCACPRTNASFSSTCVLEGENDFRCNACSLGYEGQYCEKCSSGFY
GNPIKLGGSCQPCDCDPNGSVHSFCNTTSGQCICKPGVTGHACNECEPRHILVESKCVSC
DDECVGVLLNDLDNITDAISSVNLTGIIPVPHGILSNLENTTKNLRESLASNKMTVSLER
AKKQLEGISEDTENLQKELTQVLESSQQLNVITEKILKKSQDLATLIEKLRTNIKVIVEE
AILLNESWSVNPQLPNATLQNMREDIESMLEVLQKRNLMQLHQNATAELKAAKNLLMQIQ
KNYQKPQRDLKELKEKANNYFLEYSIKLQEAQALVNEADAKTKESNRLLLIITTNLKELN
DKKLHVLENQNLSSTLIEKGKGLIAVIAALAKDAKNATEKLELHRDELLLWSAKIRHHVD
ELVMQMSKRGALNLVYRAEDHAAELMRLADLLDRGLTDVRDISLNATNAVHAHSSIQNLI
EGAEKLAVEALRKAEITNLSVEPLLSNGKVALQHGAKLLKEANNLDGKTKGVMSKMNELK
KKVNRFQEHAHKLTKQLNDSLLMLGMMMPDGTWETALKTKEMARAANESSMNTFNDIVDF
SHKLLNTSSVLSRVNETLRKTNQLLSDSSQATVLVERKVKEVKTQANLLFDRLKPLKMLE
ENLNRNLSEIKELISQARKQAASIKVAVSADRDCIRAYQPQISSTNYNTLLLNVKTSEPD
NLLFYLGSSASSDFLAVEMRHGKVAFLWDVGSGSARLEFSDFPINNDKWHRIYITRFGNT
ASLSIKEMSSTQKPLTKTAKSPGIANVLDVNESTLMFVGGLGGQIKKSPAVKVTHFKGCM
GEASLNGKSIGLWNYIEREGKCNGCFGSSQNEDSSFYFDGSGYSVVEKTLRSTVTQIIML
FSTFSPNGLLLYLASNGTRDFLSIELVDGKVKLTVDLGSGPLALITDRRYNNGTWYKIAF
QRNKKQGLLAVFDAYNTTSKETKQGESPGGSSDLNRLNKDPIYVGGLPRTRVVRKGLTSR
SYVGCIKSLEISRSTFDLLRNSYGVRKGCLLEPIRSISIFNDGYIELPPKPLSMESELMA
TFATKNSSGIILAGFSKGKDKRSRRQAHVPFFSIALIEGHLEVHINPGDGMSTRKATLHS
TTGTYSDGQEHSIVLIRNKRLITVQVDEANHTEMRFGPLAENKIINVSNLYIGGIPEGEG
TSVFRMRKSFHGCIKNLIFNMELLDFTSALSYEQVDMDSCLLSEKPRPVIHGEDVELQPE
AHPLSSPEQCAVDREVDYVPNAHQFGLALGSHLVLPFNQSAIRKKLSVQLTIRTFALSGL
IYYMAHQNQVDYATLQLHDGQLYFMFDLGKGRTKASHPAFLSDGKWHTVKTEYAKRKGFI
TIDGQESTMVTTIGDGTTLDVEGKFYLGGLPLNYRAKNIGNITYGIPACIGEVVINGKQL
DKNNPLSASSVNRCYSMAQEGTFFEGSGFVALVKDGYKVRSDVNITLEFRTTAMNGVLLG
ISSAKVDAIGIEIVNGKVSFHVNNGAGRITATYEPKSASSLCDGKWHKVQAHKSKHRIVL
IVDGNTVPAESPHTQSTSADTNNPIYVGGYPADVKQNCLSSRTSFRGCMRKLTLVKGQQV
ESIDFSKAFDIRGVFPHSCPGTEL
NT seq 9255 nt   +upstreamnt  +downstreamnt
atgctccgctgctgtgtccggggactgctcgtggcagtcctactgctgtggaacgccggg
cagtgccagcagagaggtttatttcctgccatcttgaatcttgccagcaatgctcacatc
aataccaatgctacctgtggtgagaagggcccagagatgttctgcaaacttgtagaacat
gtgccaggacgaccaatcaaaaatgcacagtgcagaatttgtgacaataacagtgctagt
ccaaaagaacgtcacccaatctcaaatgccatagatggtactaataattggtggcagagt
ccaagtattcagaatgggagagaattccactgggtgacaatcactttagacttaagacag
gtttttcaagtggcatatattattatcaaagctgctaattctcctcgacctggaaactgg
attttggaacgctccctggatggcaaaaagttcacaccctggcagtattatgctatcagc
gacacagaatgtttgactcgatataatatcactccaagattagggcctcctacttacaag
cgagatgatgaagttatctgtacctcctattattctagattagtcccacttgaacatgga
gagattcacacatcactcatcaatggcagacctagtgctgatgatctctctcccaagttg
ttggaatttacctcagcacgatatattcgtctccgcttgcagagaattagaacccttaat
gctgaccttatgactctcagccatcgtgatcctaaagatcttgaccccatagtcacaaga
agatattactattccataaaagatatttcaattggaggaatgtgtatatgctatggtcat
gctagtagctgcccatgggatgaaactacaaagaaactacagtgtcagtgtgaacataat
acatgtggagagagctgtaatgaatgctgtcctggttttcatcagcaaccttggagacct
gggactatttcttctggaaacacatgtgaagagtgcaactgtcataataaaaccaaagat
tgttactatgatcagagtgttgccgatcggaagaaaagtatgaatactgctgggcatttc
aaaggtggaggagtgtgtgttaattgtctacaaaatacagcaggaatcaactgtgaaact
tgtattgatggatactatagaccacataaagtttcgccttatgagaataatccatgtctt
ccttgtaattgtgatccttttggttcactcaattcagtctgtattaaagatgatcgccag
tctgaccagttgaatgggaactggccaggtcagtgccaatgtagagaaggttacactgga
gaaaaatgtgatcgttgtcagtttggctacaagggctatccaaattgttttcgctgcaat
tgcagtctggcgggtagtgtaaatgatgacccatgcactgagccttgtctttgtaaggaa
aatgttgaaggggaagaatgtgatcgttgcaaaccaggattttataatctgaaggaaagg
aatcctgagggttgcacagagtgtttctgctttggtgtttctgatgtgtgtgatagcctt
tcctggcctgtcagtcaggtaactgatatgtctgggtggttagtcactgacttggtcagt
tcaaataatgttcagtctcagcaaaaccaggtggatgaacctcatcaaataactatcaac
aacactgtggccatgcaaatgctaaaatctaaatattactggtcagctcctccagcatat
cttggaaataaactcacagcctttggtggaaacctgaagtatacggtgtcttatgatatt
ccaatggaaactgtggacagtgacttgatgtctcatgcagatgttattattaagggaaat
ggactcactttaagtacaagggctgaaggcttgtcactgcaaccttatgaagagtacttt
aatgtagtgaaacttgtgcctgaaaacttcagagattataataccaaaagagaaatagat
cgggaccaactgatgactgtcttagccaacgtgactcatcttttgatcagggccaattat
aatactgcaaaaaaagcattgtatagattagatgctgtaactttggacacagcaaaccca
aatgtcatagatctggtgctggctaccgatgcagaacattgtgaatgccctcaagggtat
actgggatctcctgtgagtcctgtctccctgggtattaccgtgtaggtggaatactcttt
ggaggaatctgtcaaccctgtgagtgccacagtcatgctactgaatgtgatattcatggt
gtttgcttgacttgtaaacacaacactgcaggggctcactgtgaccagtgttcaccaggt
ttctatgggaatccttctagagggacatcagaagactgccagcgctgtgcatgtcctctt
acaactgcctccaacaatttcagccctacctgccatttggatgatggagatgaagttatc
tgtgatcagtgtcaaccaggatatacaggaatgtggtgtgagagatgtgccgacggttac
tatggaaatccaacagtacctggggaaacttgtgtcccatgtgattgcaatagcaatgtg
gatcctctggaagttgatcactgcgatacagtcacaggagagtgtttgaagtgtattggg
aacacagagggccctcactgtgagagatgtgctgaaggcttctatggggatgctcttgtg
gctaaaaattgtcgtgcttgttcatgccatggaagcagctctctttccagtgtttgccat
catgaaactggtctctgcaaatgcaagccaaatgttatgggacaacattgtgatcaatgc
ttggatggcttttatggtttgaacacaggacttggttgcctgccatgcaactgtagccag
ttaggttcagtgtctgaaaactgtagtgatgaggggcagtgttactgtgtgccaggagtt
gctgggcaaagatgtgaccggtgtgctcatggcttttatgcatatcaagatggcagctgc
acaccttgtaactgtcctcatactcagaatacctgtgatccagaatccggggaatgcatc
tgccctcctcattctcaaggtttaaagtgtgaaagctgtgaggatgggtactggggacgt
gatcctgagctaggatgcaaggcttgcaattgcagcagcataggatcaactagtcaccag
tgtgatttgtcaactggccagtgctcctgtagagaaaaatatggaggacaaagctgcaat
gagtgtgctttaggtttccgagattacccagattgtgtgtcctgtgactgtgaaataagt
ggtacaaaaggagaaacgtgtgatgagaaacaaggtgtttgtagctgtgaagaagaaagt
ggcacttgtttttgcaaggaaaatgtgtttggtcttcactgcagtgaatgtaagacggga
acttttgcactccacagtgacaatcctttgggctgctctccttgtttctgttttggaatg
acacgtttctgttcagaattagaaggatatgttagaatccctataaccctcaccccggat
cagtctattctgcgtgtagtttcccaaagcaaccttgagggaacaatagagggggtgtat
taccagcaccctgagattttattggatgccgtcgctgttagacagcatgtgaattcagaa
cctttttactggaggctaccagatcagtttctgggagatcaactcatggcctatggtgga
aaactaaagtacacagtggctttttattcatcagatggtattgggacttacaacttagag
ccacagattctgataaagggtggccgcaccagtaaacttgtcatttacatgaatatccct
gctccagagaatggagtgagaaaggaacaagaagtagacatgaaggagaatatttggaaa
tattttaactctgtgtctgaaaagcctgtaacacattcagactttatgtcagttctaagc
aacattgattatattcttatcaaggcctcatatggtcaaggattattacagagcagaatt
gcaaatatttcaatggaaattggagtaaaggctgaagagatgcactccaagagagaggta
gcataccttttagagaattgtgactgtcctcctggatatgctggactttcatgtcaggat
tgtgcacctggataccatagggcaaaacttccagaagtcagtgtccgagaatcccggcct
ctgatagctccatgtgtgccatgccattgtaacaatcacactgaaacctgtcatccagag
actgggaagtgcctgaattgcagagataatacagttggtgatcactgcaatgtgtgtgct
ccaggatactatggaaaagtactcggctttaccagtgactgctctctttgtgcttgtccc
agaaccaatgccagctttagttcaacctgtgtcctggaaggtgaaaatgatttccggtgt
aatgcctgctctctaggatatgaaggacagtattgtgaaaagtgctcctctggcttctac
ggaaatcctataaagctgggcgggagttgccagccatgtgactgtgatccaaatggctct
gttcacagtttttgtaacaccacttctgggcaatgtatctgtaagccaggtgtgactggc
catgcctgtaatgaatgtgaaccaaggcatatcctggtggaaagcaaatgtgtttcttgt
gatgatgaatgtgtaggtgtattgttaaatgacttggataatatcactgatgctatttcc
tctgtgaatctcactggaatcattcctgtcccacatggaattttatccaacttggaaaat
acaactaaaaatctcagggagtcattagcaagtaataaaatgacagtttcactggaaagg
gcaaaaaagcaacttgaaggcatttcagaagacacagaaaacttgcagaaagagctcacc
caagtattagagagcagccagcagttgaatgtcatcacggaaaaaatactgaagaagagt
caagatttagccacacttattgagaaactgaggactaatatcaaagtcatcgttgaagaa
gcaatacttttaaatgagagctggagtgtcaatccacagctgcccaatgctactctgcaa
aacatgagagaggacattgaatccatgctggaagtcttacagaaaaggaatctcatgcaa
ttacaccaaaatgctactgctgagctcaaagctgccaagaatttattgatgcaaattcag
aagaattatcaaaaaccacagcgagatctgaaggagctgaaagagaaagcaaataactac
tttttggagtatagcatcaaactacaggaagcacaagctttagttaatgaagcagatgcc
aaaaccaaagagagcaaccgtctgttgcttattatcactactaatttgaaagaattaaat
gataaaaaactgcatgttttggaaaaccaaaatttgtcatctacattgattgaaaaaggg
aaaggactcatagcagttattgctgcacttgcaaaggatgccaaaaatgctacagagaag
ttagagcttcatcgtgatgagcttctcttgtggagtgccaaaatcagacatcatgtggat
gaattagtcatgcagatgtctaaaagaggagcccttaaccttgtctatagggcagaggat
catgcagctgagctgatgagactggcagatttgctagataggggccttacagatgtaaga
gatatttctctcaatgcaacaaatgctgtccatgcccattccagtatccaaaacttgatt
gaaggtgcagaaaaattggctgtggaagctctcaggaaagcagaaattacaaatttgtca
gtggaacctcttctttctaatgggaaagtagctctccagcatggtgccaaacttctaaag
gaagccaacaatctggatggaaaaactaaaggtgttatgtccaaaatgaatgaattgaag
aaaaaggtaaacagatttcaggagcatgctcataaacttactaagcaacttaatgattca
ctgctgatgcttggaatgatgatgcctgatggtacctgggagacagcactgaagaccaaa
gagatggctcgagctgctaatgagagcagcatgaacactttcaatgacattgtggatttc
agtcacaagctgcttaacacttcatctgtattgtccagggttaatgaaacattgagaaaa
accaatcagcttctaagtgactcatcacaggctactgtgttggttgaaaggaaagtaaaa
gaagtgaaaacacaagccaatcttttatttgatcgtttgaagcctttgaaaatgcttgag
gagaacttgaacagaaacctgtctgaaattaaagagttgatcagtcaggcccgaaagcag
gcagcatctattaaagtggctgtatctgcagatcgagattgtatccgtgcctaccagcct
cagatatcctctaccaactacaatactttactgttaaatgttaaaaccagtgaacctgat
aacctcctgttctatctgggtagcagtgccagctctgactttcttgctgttgagatgcgg
catggcaaggtagccttcctttgggatgtaggctctgggtctgcaagattggaattttca
gacttcccaataaataatgataaatggcaccgaatatatataaccagatttggaaatact
gcctcattgagtataaaggaaatgagctctacccagaagccattaaccaaaactgctaaa
tcccccgggatagctaatgtgctagatgtaaacgagtcaacattaatgtttgttggagga
cttggaggacaaataaagaaatcacctgctgtgaaagttactcattttaaaggatgcatg
ggagaggcatctttgaatggaaaatctattggtctttggaactatattgaaagggaaggc
aaatgcaatggctgttttggaagttcacagaatgaagattcttcattttattttgatggt
agtggatattcagttgtggaaaaaacactccggtctactgtcactcaaataataatgctt
ttcagtactttttcacccaatggtcttctcctctaccttgcttctaatggcacaagagat
ttcctctctattgagctggttgatggcaaagttaaactaaccgttgacctgggttcagga
cctcttgctcttattacagacagacgttataataatggaacctggtacaagattgcattc
caacgtaacaaaaagcaaggacttctagcagtttttgatgcatataataccacttctaaa
gaaacaaagcaaggtgaatctcctggagggtcatctgacctaaatcgcttgaataaggat
ccaatttacgttggtggattgcccagaacaagagttgtaaggaaaggacttactagcaga
tcatatgtaggctgtattaaaagcctggaaatatccagatctacatttgacttactcaga
aattcctatggagtaagaaaagggtgtttattggagcctattcgaagtattagcatcttt
aatgatgggtacattgaattaccaccaaagccactctccatggagtctgagttaatggca
acatttgccactaagaacagtagcggcattattctggctggttttagcaagggaaaggat
aagagaagtcgccgacaggcccatgtgcccttcttctccatcgcactgattgagggtcat
cttgaagtacatattaatcctggagatggaatgagcactcgaaaagctactctccattcg
accacaggaacatacagtgatggacaagaacattccattgtcttgattaggaataaaaga
ctcatcacagtacaagtagatgaagctaatcatacagaaatgagatttgggccactagca
gaaaacaaaatcataaatgtatctaacctgtacataggtggaatcccagaaggtgaaggc
acttctgttttcagaatgagaaaatcttttcatggctgtataaaaaacttgatcttcaat
atggagcttttggatttcaccagtgcacttagctatgagcaagtggacatggatagttgc
ctgctttcagaaaagcctcgaccagttatccatggagaggatgttgagcttcagccagag
gctcatcccttatcaagtcctgagcagtgtgcagtggatagagaggtggactatgtcccc
aatgcccatcagtttggactggctctaggcagtcacctggttttgcctttcaaccaatct
gctatcagaaagaagctttcggtgcagctgaccatccgaacctttgccttaagtggcctg
atttattacatggcccatcagaaccaagttgattatgcaacacttcagcttcatgatgga
cagctctacttcatgtttgatcttggaaaagggagaacaaaagcttcccatcctgccttc
ctcagtgatggaaaatggcacacagtgaaaacagagtatgccaaaaggaagggtttcatc
acaatagatggacaagagtcaacaatggtgaccacaattggagatggtaccaccttagat
gtggaaggaaaattttaccttggaggccttccattaaattacagagccaagaatattgga
aatattacctatggcatccctgcctgtattggggaggtggtgattaatggcaaacagctt
gacaaaaacaacccactgtctgcctcttctgtaaatagatgctattcaatggcacaggaa
ggtactttctttgaagggagtggatttgttgcacttgtcaaagatggctacaaagttcga
tcagatgtcaatataacattagagtttcgtaccactgcaatgaatggtgttcttcttgga
attagtagtgccaaagtagatgctattggaatagaaattgtaaatggcaaggtttcattc
catgtcaacaatggagctggtaggattacagctacatatgaacccaaatctgcaagtagt
ctttgtgatggaaagtggcacaaggttcaagcccacaagagcaaacaccgcattgtttta
attgttgatggaaatactgttcctgctgaaagtccacatactcagtccacatctgcagat
accaacaatcccatctatgttggaggatatcctgctgatgtaaagcaaaactgtctgagc
agtcggacctccttccggggttgtatgagaaagctcacattggttaagggtcaacaagtg
gaatccattgacttcagcaaagcttttgacatccgaggagtgttccctcactcctgccct
gggactgagctctaa

KEGG   Sarcophilus harrisii (Tasmanian devil): 100926054
Entry
100926054         CDS       T02286                                 

Gene name
LAMA4
Definition
(RefSeq) laminin subunit alpha-4 isoform X1
  KO
K06241  laminin, alpha 4
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr04151  PI3K-Akt signaling pathway
shr04510  Focal adhesion
shr04512  ECM-receptor interaction
shr05143  African trypanosomiasis
shr05145  Toxoplasmosis
shr05146  Amoebiasis
shr05165  Human papillomavirus infection
shr05200  Pathways in cancer
shr05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:shr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100926054 (LAMA4)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100926054 (LAMA4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100926054 (LAMA4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100926054 (LAMA4)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100926054 (LAMA4)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100926054 (LAMA4)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100926054 (LAMA4)
   05145 Toxoplasmosis
    100926054 (LAMA4)
   05143 African trypanosomiasis
    100926054 (LAMA4)
SSDB
Motif
Pfam: Laminin_G_2 Laminin_G_1 Laminin_I Laminin_II Laminin_EGF Laminin_G_3 DUF5310 DUF2513
Other DBs
NCBI-GeneID: 100926054
NCBI-ProteinID: XP_031820246
LinkDB
Position
4
AA seq 1822 aa
MALISAWSYAFPILLFLGCLSSSNAAVEGSAFQFDIEGSSAISKQDLTDNREPSLAAGNP
VLFAESCGVGFFHSVTGECLPCDCNGNSNECLDGSGFCVNCQRNTTGEHCEKCPDGFIGD
VIRGAPRLCQPCPCPLPHMANFAVSCYRKSGVVRCICKEKYAGPNCERCAPGYYGNPLLI
GSTCKKCDCSGNSDPNLIFEDCDEVTGQCRNCLRNTTGFKCEQCAPGYYGDARIAKNCAV
CNCRGGPCDSETGECLEESFEAPTGTDCPTISCDKCIWDLTDDLRLAALAIDESKSNLLS
VSSGVAAHRHVNEINSTVYLLKAKFSERENQYLLRKIQISDAENTMKDLLSDLEELTEKE
NRAAKKSQLVHKETMDTINYATQLVEDAHNMRDKIQEINSKMLYYGVEQDLSPEEISEKL
VLAEDMLMEIKRRKPFFLQRELVDEEADEAQELLSLAENWQRLHNDTRSLFPVVLEQLDD
YDAKLSELQESLEESLDRVRDAEHLNRANAARQRDNEKQHERIKEQVEVVNTSLSESTES
LEIPRLTISELSDVIKNASRIYAEIDGAKTELQDKLSNLTTLDHDLVQQAVEHAQDLQQQ
ANELNSSLHRLDTNGLVQKALDASNVYENIINYVHEANESAVLALSITDRVNDAVVGIDT
QITYHKDESENLLSQAKTLQAAADSSNEQAVADTSQRVDGAQARKTFLKSRLDEAIKKLQ
AAEKGDAEQRLDHSKRIIAEAEKTTMVVGRETTPMMNNLTNWSQSLHHFDSSAYNTAVDS
ARAAVRNLTEVVPQLLDQLRTVEQKRSASNVSDSIRRIRELIAQTRSVASKIQVSMMFDG
QSAVEVNTKTSVDDLKAFTSMSLYMKPPAKSAVKNENADRFILYLGSKNAKSDYMGLAIK
NDNLVYIYNLGNKEVEIPLDSKPVSTWPAHFSIVKIERVGKHGKIFLTVPSLTSTAEEKF
IKKGEVSGDDSLLDLSPEDTVFYVGGVPPNFKLPASLNLPGFIGYLELATLNNEVISLYN
FKHIYNMDPSKSIPSARDKLAFTQSRAASYFFDGSSYAVVRDITRRGKFGQVTRFDIEVR
TPTANGLVLLMVNGSTFFSLEMRNGYLNVFYDFGFSNGPVHLEDSQKKAPINDAKYHEIS
IIYHNDKKMILVVDRRHVKSMDNEKMKIPFTDIYIGGAPPEVLQSSNIKVHLPLDVNFRG
CMKGFQFQKKDFNLLEQPETLGVGYGCPEDSLISRRAYFNGQGFIASSQKISFFDAFEGG
FNFRTLQPNGLLLYYAAGSDIFSISMDKGTVILNVKGIKVQSTDKKYDDGQSHFIIASIS
PTRYELIVDKDRLGKNNPSKGKTDQTPARESKFYFGGSPISPQYVNFTGCISNAYFTRLD
RDIEVEDFQRYSEKIQTSLYECPIETAPISLLHKKGKNSSKPKINKNKKNEKNKDSPRNP
IGLKTLKQNVFRDSHCQLSSSPKAISHAYQYGGTANSRQEFEHLKGNFAEKSQFSIRLKT
RSSHGMIFYVSDQEENDFMTLFVAHGRLVFMFNAGHKKLKLRSQEKYNDGLWHDVIFIRE
KNSGRLIIDGLRVLEESFPPTGADWKIEAPIYLGGVAPGKAIKNVQINSVYSFSGCLSNL
QLNGTSITTASQTFSVTPCFEGPMESGTYFSSEGGYVILDESFNIGLKFEIAFEVRPRSS
SGILVHGHSVNGEYLNVHMKNGQVITKVNNGIRDFSTSVTPKQSLCDGRWHRITVIRDSN
VVQLDVDSEVNHVVGPLNPKSVDHREPVFVGGVPESLLTPSLTMGRPFSGCIRNFVIDER
PVSFSKAALVSGAVSINSCPAA
NT seq 5469 nt   +upstreamnt  +downstreamnt
atggctttgatctctgcctggtcttatgcttttcctatactgctgtttttgggatgcttg
tcctccagcaatgcagcagtggaaggcagcgcttttcagtttgacattgaaggtagttct
gcaatcagcaaacaagacttgactgataacagagagccatcactagctgctgggaatccg
gtgctttttgctgagagctgtggagtgggattttttcactctgtgactggagagtgctta
ccatgtgattgtaatgggaattcaaatgagtgtctggatggctctggattctgtgtgaac
tgtcaacggaacactactggagaacactgtgaaaagtgtccagatggtttcattggggat
gtcatcagaggagctcctagactctgtcagccatgcccttgccccctgccccatatggcc
aattttgcagtatcctgttacagaaaaagtggtgtggtacgatgtatttgtaaagaaaaa
tatgctggccctaactgtgaaaggtgtgcccctggttactatggaaaccccttactgatt
gggagcacctgcaagaaatgtgactgcagtggaaattcggatcccaacctgatatttgag
gattgtgatgaagttactggccagtgtcgcaactgcttacgaaataccaccggattcaaa
tgtgaacaatgtgcccccggatattatggggatgccaggatagctaagaactgtgcagta
tgcaattgcaggggaggaccatgtgacagtgaaactggagaatgccttgaagaaagtttc
gaagctcctacaggcacggactgcccaactataagctgtgacaaatgcatctgggatttg
actgatgacctacgattagcagctcttgctatcgatgaaagcaaatcaaatttgttgagt
gtatcatctggagtagctgctcacaggcatgtaaatgaaatcaattctactgtttacctc
ctcaaggcaaagttttcagaaagagaaaaccaatacctcctaagaaaaatacagatcagt
gatgctgagaatacaatgaaggatcttctctctgatttggaggaactaactgaaaaggaa
aatcgagctgcaaaaaaaagccagctggttcataaggaaactatggataccatcaactat
gcaacccaacttgtagaagatgcccataatatgagagataagatccaagagatcaacagc
aagatgctatattatggagttgagcaagaccttagtcccgaagaaatctctgaaaagctt
gtattagcagaggacatgctgatggaaatcaaacgtcgaaagcccttcttccttcaacgg
gagcttgtggatgaagaggctgatgaagcgcaagaactgttatccctcgctgaaaactgg
caacggctccacaatgacacaaggtcactgtttcctgtggtattagagcagcttgatgac
tatgacgccaagttgtcagaacttcaagagtcactggaagaatctcttgaccgtgtcaga
gatgctgaacacttgaacagggccaatgctgccagacaacgggacaatgagaaacaacat
gaaagaatcaaagaacaggtagaagtggtgaacacttctttgagtgaatccacagaatct
ctagaaatccctcgtctgaccatctctgaactaagtgatgtcataaagaatgcatcaagg
atttatgccgaaatcgatggagccaaaacagagctacaagataaactctccaatttgacc
actctcgatcatgacttggtccagcaagctgtagagcatgcacaggaccttcagcaacag
gctaatgagctaaatagcagtctccacagattggatactaatggattagtacagaaggct
ctggatgcatcaaatgtctatgaaaatatcatcaactatgtccatgaggccaacgagtca
gcagtactagctttgagcattacagacagagtcaatgatgctgtagttgggattgacact
cagatcacttaccacaaagatgaaagtgaaaatcttctcagtcaagccaagacactgcaa
gcagcagcagattctagcaacgaacaggctgtggctgataccagccagcgtgtggatgga
gcccaagctcgaaagacttttctgaaaagcaggctagatgaagctattaagaaacttcaa
gcagcagagaaaggggatgcagagcagcgtctggatcactcaaagcgaatcattgcagaa
gctgagaagacgaccatggtggtaggccgagaaaccaccccaatgatgaacaatctaacc
aactggtcacagagtcttcaccattttgattcttcggcctacaacactgcagtagactct
gctagagctgcagtaagaaatttgactgaagtcgtcccccagctcctggatcagctgcgt
acagtggagcagaagaggtctgcaagcaacgtttcagacagcattcggaggatcagagag
ctcattgcacagaccaggagtgtagctagcaagattcaagtctccatgatgtttgatggt
cagtcagcagttgaagtcaacaccaaaactagcgtggatgacttaaaagcctttacttcc
atgagcctgtacatgaaacctccagcaaaatcagcagtgaagaatgagaatgcagataga
tttatcttatatcttggaagcaaaaatgcaaaaagtgattatatgggtcttgcaatcaaa
aatgataacctggtatacatttataatctgggaaacaaggaagtggagattcctctagac
tctaaaccagtcagcacttggccagcccacttcagtattgtcaaaattgaaagggtagga
aaacatgggaaaatattcctaacagttccaagcctaactagcacagctgaagaaaagttt
atcaagaaaggagaagtctctggcgatgactccctcctagatttgagtccagaggacact
gtcttttatgttggaggagtgccaccaaattttaagcttcctgctagtttgaatctgccc
ggtttcattggttatctggagttggctactttgaataatgaggtgatcagtttatataat
tttaagcacatctacaacatggacccttcaaaatcaatacccagtgcaagggataaactg
gccttcactcaaagtcgggctgccagttatttctttgatggttcaagttatgcagtggta
agggatatcacaagaagaggaaaatttggacaagtaacacgttttgacattgaagttaga
acaccaacagccaatggtttggtgctcctcatggtgaatgggagtacatttttcagcctg
gagatgagaaatggctacctgaatgtattttatgattttgggttcagcaatggccctgtg
catcttgaagactcccagaagaaagcgccaattaatgatgcaaaataccacgagatttca
atcatttaccacaatgataaaaaaatgattttggtagttgacagacggcatgtgaaaagc
atggataatgaaaaaatgaaaataccttttacagatatatacattggaggagctcctcca
gaagtgttacaatccagtaatataaaagtacaccttccattagatgttaacttcaggggc
tgcatgaagggtttccagttccaaaagaaggatttcaatttattggagcagccagaaaca
ttaggagtaggttatggctgcccagaagactcacttatatcccgcagagcatatttcaat
ggacagggtttcattgcttcaagccagaaaatatctttcttcgatgcctttgaaggaggt
tttaatttccggacactgcagcccaatggactactactctattatgctgcagggtcagat
atattttccatttccatggataagggaacagtaatattaaatgtaaagggaatcaaagtt
cagtcaacagataaaaagtatgatgatggtcaatctcatttcatcattgcctctatatca
cccacaagatatgaactcatcgtggataaggacagattgggtaaaaataatccaagcaaa
ggaaaaacagaccagactcctgccagagagagcaagttctattttgggggctcaccaatc
agtccccagtatgttaatttcactggatgcataagcaacgcttatttcaccaggttggac
agggatatagaggtagaagattttcaacggtactctgagaaaatccaaacctccctttat
gagtgccccattgaaacagcaccaatttctctcctgcacaaaaagggaaaaaattcctca
aagcccaaaataaataagaacaaaaagaatgagaaaaataaagactcacctcggaatcca
attggcctgaaaaccttaaaacagaatgttttccgggactctcactgtcaactttctagc
agtccaaaagcaatctcccatgcctatcaatatggagggacagctaacagccgccaagag
tttgaacatttaaaaggaaattttgctgaaaagtctcagttttctattcgtttgaaaact
cgctcttcccatggaatgatcttctatgtctctgatcaagaagaaaatgatttcatgact
ctttttgtggcacatggacggctagtcttcatgtttaatgctggccataaaaaactgaag
cttaggagtcaggagaagtataatgatggattgtggcatgatgtgatatttattcgagaa
aaaaacagtggtcgtttgataattgatggtctccgggtcctagaagaaagttttcctcct
actggtgctgattggaaaattgaggcacctatttacttgggaggtgttgctcctggaaaa
gctattaaaaatgtccagatcaattcagtctacagtttcagtggttgtcttagcaatctt
cagctcaatgggacctcaattactacagcttctcaaacattcagtgtgactccttgtttt
gaaggtccaatggaaagtggaacgtatttttcatcagaaggaggatatgtgattctagat
gagtctttcaatattggattgaagtttgaaatagcctttgaagttcgtcccagaagtagt
tcaggaatcctggtccatggtcacagtgtgaatggagagtatctgaatgttcacatgaaa
aatggtcaggtcataacaaaggtcaacaatggtatcagagacttttctacttcagttaca
cccaaacagagtctctgtgatggcagatggcacagaataacagttattagagattccaat
gtggttcaactggacgtagattctgaagtcaaccatgtggttggtcccctcaatccaaaa
tcagttgatcacagagaaccagtatttgttggaggtgtgccagagtctcttctgacacca
agcttgaccatgggtagacccttctctggctgtatccgaaacttcgtgattgatgaacgt
ccagtaagcttcagtaaagcagcactggtcagtggtgctgtgagcattaattcttgtcca
gcagcctaa

KEGG   Sarcophilus harrisii (Tasmanian devil): 100927509
Entry
100927509         CDS       T02286                                 

Gene name
FN1
Definition
(RefSeq) fibronectin isoform X4
  KO
K05717  fibronectin 1
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr04151  PI3K-Akt signaling pathway
shr04510  Focal adhesion
shr04512  ECM-receptor interaction
shr04810  Regulation of actin cytoskeleton
shr04933  AGE-RAGE signaling pathway in diabetic complications
shr05100  Bacterial invasion of epithelial cells
shr05135  Yersinia infection
shr05146  Amoebiasis
shr05165  Human papillomavirus infection
shr05200  Pathways in cancer
shr05205  Proteoglycans in cancer
shr05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:shr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100927509 (FN1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100927509 (FN1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100927509 (FN1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100927509 (FN1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100927509 (FN1)
   05205 Proteoglycans in cancer
    100927509 (FN1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100927509 (FN1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100927509 (FN1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100927509 (FN1)
   05100 Bacterial invasion of epithelial cells
    100927509 (FN1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100927509 (FN1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100927509 (FN1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:shr04131]
    100927509 (FN1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:shr04147]
    100927509 (FN1)
   00536 Glycosaminoglycan binding proteins [BR:shr00536]
    100927509 (FN1)
   04990 Domain-containing proteins not elsewhere classified [BR:shr04990]
    100927509 (FN1)
Membrane trafficking [BR:shr04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   ER-Golgi intermediate compartment (ERGIC) proteins
    100927509 (FN1)
Exosome [BR:shr04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   100927509 (FN1)
Glycosaminoglycan binding proteins [BR:shr00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   100927509 (FN1)
Domain-containing proteins not elsewhere classified [BR:shr04990]
 Fibronectin (FN) domain-containing proteins
  Fibronectin type I domain-containing proteins
   100927509 (FN1)
SSDB
Motif
Pfam: fn3 fn1 Pur_ac_phosph_N fn2 DUF2369 Interfer-bind DUF4959 Arylsulfotran_N
Other DBs
NCBI-GeneID: 100927509
NCBI-ProteinID: XP_012401840
Ensembl: ENSSHAG00000009319
LinkDB
Position
3
AA seq 2392 aa
MHRDPVPGRRLLLLLLLALCVGTSVQEAKSKKTRRQTQQKVQPPSPVAVSQSKTGCYDNG
KHYQINQQWERIYLGNALVCTCYGGSRGFNCESKPEPEETCFDKYTGNTYRVGDTYERPK
DSMIWDCTCIGAGRGRISCTIANRCHEGGQSYKIGDTWRRPHETGGYMLECVCLGNGKGE
WTCKPVAERCYDNTGGTSYVVGETWEKPYQGWMMVDCTCLGEGSGRITCTSRNRCNDQDT
KTSYRIGDTWSKKDNRGNLLQCICTGNGRGEWKCERHSSLQTTATGPGSVTDVRTALYQP
QPQPQPAPYGHCVTDSGVVYSLGMQWLKTQGNKQMLCTCLGNGVSCQETAVTQTYGGNSN
GEPCVLPFTYNGRTYYSCTTEGRQDGHLWCSTTSNYEQDQKYSFCTDQNVLVQTRGGNSN
GALCHFPFLYNNRNYTDCTSEGRRDNMKWCGTTINYDADQKFGFCPMAAHEEICTTNEGV
MYRIGDQWDKQHDMGHMMRCTCVGNGRGEWTCVAYSQLRDQCIVDGITYNVNDTFHKRHE
EGHMLNCTCFGQGRGRWKCDPIDQCQDSETRTFYQIGDSWEKYVHAVRYQCYCYGRGIGE
WHCQPLQTYPGTTGPVQVIITENPSQPNSHPIQWNAPEPSHISKYILRWKPKNSPNRWKE
AIIPGHLNSYTIKGLRPGVIYEGQLISVQHYGHKEVTRFDFTTTSTSPAVSTNTVTGETT
PFSPVVATSESVTEITASSFVVSWVSASDTVSGFRVEYELSEEGDEPQYLDLPSTATSVN
IPDLLPGRKYIVNVYQISEEGEQNLILSTSQTTAPDAPPDHAVDKVDDTSIVIRWSRPQA
PITGYRIVYAPSVEGSSTELNLPETANSVTLSDLQPGVQYNITIYAVEENQESAPIFIQQ
ETTGVQRPDKVPPPKDLQFVEVTDVKVTIMWTPPESAVTGYRVDVVPVNLPGEHGQRLPV
SRNTFAEVTGLSPGVTYYFKVFAVNQEKESTPLTGEQTTKLDAPTNLRFVNETDTTVLVT
WTPPRARIAGYRLTVSPTRGNQPKQYNVGPSATQYPLRNLQPGSEYTASLVAVKGNQQSP
KQTGIFTTLQPASSIPHYNTEVTETTIIITWTPAPRIGFKLGVRPSQGGEAPREVTSESG
SIVVSGLTPGVEYIYSISVLQDGQEKDAPIVKKVVTPLSPPTNLHLDSNPDTGILTVSWE
RSTTPDISGYRITTTPTNGREGYSLEEVVHGDQSSCTFENLSPGLEYNVSVYTVKGDKES
VPISDTIIPAVPPPTDLRFTNVGPDTMRVTWAPPPSIELTNLLVRYSPVKNEEDVAELSI
SPSDNMVVLTNLLPGTEYLVSVSSVYEQHESIPLKGRQKTGLDSPTGIDFSDITANSFTV
HWMSPRAPNTGYRIRHHPEHASGRPREDRVPPSRNSITLTNLKPGTEYVISIVSVNGREE
SAPLVGQQSTVSDVPRDLEVIATTPTSLLIRWDAPAVTVRYYRITYGETGGNSPVQEFTV
PGTKSTATITGLKPGVDYTITVYAVTGRGDSPASSKPVTISYRTEIDKPSQMQVTDVQDN
SISVRWLPSNSPVTGYRVTTAPKNGPGPSKTKTTGPDQTEMTIEGLQPTVEYVVSVYAQN
QNGESQPLVQTAVTNIDRPKGLAFTDVDVDSIKIAWESPQGQVSRYRVTYSSPEDGIHEL
FPAPDGEEDTAELQGLRPGSEYTVSVVALHDDMESQPLIGIQSTAIPSPTNLKFTQVTPT
SLTAQWTAPNVQLTGYRVRVTPKEKTGPMKEINLSPDSTSVVVSGLMVSTKYEVSVYALK
DTLTSRPAQGVVTTLENVSPPRRARVTDATETTITLNWRTKTETITGFQIDAIPSNGQSP
VQRTINPEIRSYTITGLQPGTDYKIHLYTLNDNARSSPVVIDASTAIDAPSNLRFLTTTP
NSLLVSWQPPRARITGYIIKYEKPGSPSREVVPRPRPGVTEATITGLEPDTEYTIYVIAL
KNNQKSEPLMGRKKTDELPQLVTLPHPNGPEILDVPSTVQKTPFITNPGYDNGNGIQLPG
TTGQQPSVGQQMIFEEHGFRRTTPPTAATPIRHRPRPYPPNVDEEIQIANIPRGDADHLP
YPHVLGLNPNASTGQEALSQTTISWTPFQESSEYIISCHPIGIDEEPLQFRVPGTSASAT
LTGLTRGATYNIIVEALKNQRRHKVREEMITVGNSVNEGLNQPTDDTCFDPFTVTHYSIG
EEWERLSDSGFKLWCQCLGFGSGHFRCDSSKWCHDNGVNYKIGDKWDRQGENGQMMSCTC
LGNGKGEFKCDPHEATCYDDGKTYHVGEQWQKEYLGAICSCTCFGGQQGWRCDNCRRPGV
ETAPEGSAGHSYSQYSQRYHQRTNTNVNCPIECFMPLDVQADTENSRDSLEK
NT seq 7179 nt   +upstreamnt  +downstreamnt
atgcacagggacccagtcccgggacggcggctgctgctgctactgctacttgcactatgt
gtgggaacatcagtgcaagaggcaaagtcgaagaaaacccggaggcaaactcagcaaaag
gttcagcctccgtcccccgtggctgtcagccaaagcaaaaccggctgttatgataatgga
aaacactatcagatcaatcaacaatgggaacgaatttatctgggcaatgcactggtttgt
acctgctatggaggcagcagaggttttaactgtgagagcaaacctgaacctgaagaaaca
tgctttgacaaatatactggaaacacctaccgggttggggacacttatgagcgcccaaag
gattcaatgatttgggattgtacttgcattggcgctggccgagggagaatcagctgtacc
attgcaaatagatgtcatgaaggaggccagtcatacaaaataggtgatacctggcgccgc
ccacatgagactggaggctacatgcttgagtgcgtttgtcttgggaatggaaaaggagaa
tggacctgcaaacctgtagctgaaaggtgctatgataacactggtggaacttcctatgtt
gttggagagacttgggaaaagccctatcaaggctggatgatggtggattgtacctgttta
ggagaaggcagtggacgtatcacatgtacctctagaaatagatgtaatgatcaggacacc
aagacatcctatcgaattggagacacctggagcaagaaagacaatcgtggaaatttgctt
cagtgtatctgcactggtaatgggaggggagaatggaaatgtgaaagacattcatcttta
caaacaactgctacagggcctggctctgtcacagatgttcggacagcactgtaccagcct
cagcctcagcctcagcctgctccatatggtcattgtgtcactgatagtggtgtggtctac
tctctgggaatgcagtggctcaagacccaaggaaacaaacagatgttatgcacatgtctg
ggcaatggtgtcagctgccaggaaaccgctgtaactcaaacctatggtggcaattccaat
ggagaaccatgtgtcttgccattcacatacaatggcaggacttactattcttgtacaact
gaaggtcgtcaggatgggcatctttggtgtagtaccacttcaaattatgaacaagaccag
aaatattctttctgtacagaccagaatgttctggttcagactcgaggtggcaattccaat
ggtgccttgtgtcacttcccattcttgtacaacaaccgtaattacaccgactgtacttca
gagggaaggcgagacaacatgaaatggtgtggaaccaccatcaactacgatgctgatcag
aaatttggattctgtcctatggctgctcatgaagagatctgcactaccaatgagggggtc
atgtatcgcattggagatcagtgggacaaacagcatgatatgggacatatgatgaggtgc
acatgtgtaggaaatggtcgaggggaatggacctgtgtggcgtattcacagctcagagat
cagtgtattgtcgatggtattacatataatgtgaatgatacattccataagcgtcatgaa
gaaggtcatatgctgaactgcacatgttttggccagggccgtggaaggtggaaatgtgat
cccattgaccaatgccaggattcagaaacccgtacattctaccagattggagattcatgg
gagaaatacgttcatgctgttagatatcaatgctactgttatggccggggaattggagaa
tggcactgccaacccttacagacctatccaggcacaactggtccagtccaagtaatcatc
actgaaaaccctagtcagcccaattctcatcctatccagtggaatgcacctgaaccatct
cacatttccaagtacattctcagatggaagcctaaaaattctccaaatcgctggaaagag
gctattattcctggtcatttaaattcttacacaatcaaaggtctacggcctggtgtgatt
tatgagggacagcttatcagtgtacaacactatggacacaaggaagtcactcgttttgac
ttcactaccactagcaccagccctgctgtgtccaccaacacagtcacaggagagacaaca
ccattttctcctgttgttgcgacttcggaatctgttacggaaattacagccagcagcttt
gtggtctcatgggtctcagcctctgacactgtctctggattccgggtggaatatgaactg
agcgaggaaggtgatgagccacagtaccttgatcttccaagcacagccacttctgttaac
attcctgacttgcttcctggacgcaaatatattgtaaatgtctatcagatctctgaagaa
ggagaacaaaatctgatcctgtctacctcacagacaacagcacctgatgctcctcctgac
catgcagtggacaaagtagatgacacctcaattgtcattcgctggagcagaccacaggcc
cccatcacaggttacagaattgtctatgccccatcagttgaaggaagcagcacagagctc
aatctcccagaaactgctaattctgtaactcttagtgacttgcaacctggggttcaatat
aacatcactatttatgctgtggaagaaaatcaagaaagtgcccccatcttcattcagcaa
gaaaccactggagttcagcgtccagacaaagttcctcctcctaaggatctgcagtttgtg
gaagtgacagatgtcaaagtcaccatcatgtggaccccccctgaaagtgcagtgactggc
taccgggtggatgtggtccctgtcaatcttcctggggagcatgggcagaggctgccagtc
agcaggaatacttttgctgaggtcactgggctctcccctggagttacctattacttcaag
gtctttgcagtgaaccaggaaaaagagagcactccattgacaggagaacagaccactaaa
ctggatgctcctactaacttaaggtttgtcaatgagactgacaccacagtcttggttacc
tggactccacctcgtgccaggatagcaggatatcgactgactgtgagtcctactagggga
aaccaacctaagcaatataatgtgggaccatctgccacccaatacccattgaggaatctg
caaccagggtctgagtacactgcttccctagtggctgtcaaaggcaatcaacagagtcct
aagcaaactggaatcttcactaccttgcaacctgccagttccattcctcattacaataca
gaagtgactgaaacaacgattatcatcacctggacaccagctccaagaatcggttttaag
ttgggtgtacgaccaagtcaaggtggagaagctcctcgtgaggtgacttcagagtctgga
agcattgttgtgtctggcctgactccaggagtggaatatatatattctatttctgtctta
caagatggtcaggagaaagatgctccaattgtaaagaaagtggttacaccactgtctcca
ccaaccaacctccacttggattcaaacccagacactggaatcctaactgtctcctgggaa
agaagcaccaccccagacatttctgggtatagaataaccacaacacctacaaatggccga
gagggttattctctggaagaagtggtccatggagatcagagttcctgcacttttgaaaat
ctgagtcctggcctggagtacaatgtcagtgtgtacactgtcaaaggtgacaaggaaagt
gtccccatctccgataccatcattccagctgtccctcctcccactgacctgagattcacc
aatgttggcccagacaccatgcgtgtgacatgggctccacccccatctattgaattgact
aacctattggtacgatattcacctgtgaaaaatgaggaagatgtcgcagagttgagcatt
tctccttcagataacatggtggttctaacaaatctccttcctggtactgagtacttggtc
agtgtttccagtgtttatgaacaacatgagagcatacctcttaaaggaagacagaaaaca
ggtcttgattccccaactggcattgacttttctgatataactgccaactccttcactgtc
cattggatgtctccacgggcccccaatactggctatagaattcgccaccatcctgaacat
gctagtggaagacctcgtgaagaccgggttcccccatcaagaaactccatcacacttact
aacctgaaaccaggcacagaatatgtgatcagcattgtatctgtcaacggcagagaggaa
agtgccccattggttggccaacagtcaacagtttctgatgttccaagggaccttgaagtg
attgctactacccccactagcctgcttattcgttgggatgcacctgcagttaccgtcaga
tattatagaatcacctatggtgaaacaggaggaaatagccctgtgcaggagttcactgtg
cctggaaccaaatctacagccaccatcaccggccttaaacctggagtagattataccatc
actgtgtatgcagtaaccggtcgtggagacagtccagccagcagcaaacccgtgaccatt
tcataccgaacagaaattgataaaccatcacaaatgcaagtgactgatgtgcaggacaac
agcatcagtgtgaggtggctaccttcaaattccccagtcactggttacagagtgaccact
gctcccaaaaatggccctggaccatctaaaacaaaaactactggcccagatcaaacagaa
atgaccattgaaggactgcagcccacagtggaatatgtagttagtgtctatgctcagaat
caaaatggagagagtcagcctctggtgcagactgcagtcactaacattgatcgccctaaa
ggactggcattcactgatgtggatgtcgattccatcaaaattgcttgggaaagcccacag
gggcaagtttccaggtatagggtgacctactcaagccctgaggatggaatccatgagcta
tttcctgcccctgatggtgaagaagatacagcagaactgcagggtctcaggcctgggtct
gagtacacagtcagtgttgttgccttgcacgatgatatggagagccagcccctgattgga
atccagtccacagctattccttcaccaaccaacctgaagttcactcaggttactccaacc
agcttgacagcacaatggacagcacccaatgttcaactcactggatacagagtgcgagtg
acacccaaggaaaagacaggaccaatgaaggaaatcaacctttctccagatagcacctca
gtggtggtatcaggactaatggtatcaactaaatatgaagtcagtgtctatgctcttaag
gatactctcaccagcaggccagcacagggtgtagttactactttggagaatgtcagtcct
ccacgtagagcccgtgtgacagatgctactgaaaccaccatcactctcaactggagaacc
aagacagaaactatcacaggtttccagattgatgctatcccctccaatggtcaaagccct
gtacagagaacaatcaaccctgaaatcagaagctataccattactggtttacaaccaggc
actgattataagatccacctctacactctaaatgacaatgcccgaagctcacctgtagtg
attgatgcttcaactgccattgatgcaccatccaacctgcggttcctcacaacaacacct
aactcactgcttgtttcatggcaaccaccccgagctcggatcactggctacatcatcaag
tatgagaagcctgggtcaccttcccgagaggtggtccctcgacctcgtcctggggtcaca
gaggccactatcactgggctggaaccagatactgagtataccatctatgtcattgccttg
aagaacaatcaaaagagtgaaccattgatgggaagaaaaaagacagatgagcttccccaa
ctggtaacccttccacaccctaatggaccagagatcttggatgttccctccacagttcaa
aagacccctttcatcacaaatcctgggtatgacaatggaaatggtatacagcttccaggc
actaccggccagcaacctagtgttgggcaacaaatgatctttgaggaacatggctttagg
cggactacaccacccacagcagcaacccccataaggcataggccaagaccatacccaccg
aatgtagatgaggagattcagattgctaacatccccaggggggatgcagatcatcttcca
tatcctcatgttcttgggctcaatccaaatgcctctacaggacaagaagctctctctcag
actaccatctcttggacaccattccaggaaagttctgaatatatcatttcatgccatccc
attggcattgatgaagaacctttacagttcagagttcctggaacttcagctagtgccaca
ctgaccggccttacccgaggggctacctacaacatcatagtggaggccctgaaaaaccag
aggagacacaaagttcgggaagagatgatcacagtgggcaactctgttaatgaaggattg
aaccaacctacagatgacacatgttttgatccattcactgtcactcactattccatcgga
gaggaatgggagcgattatctgactctggctttaaactctggtgccaatgcttaggtttt
ggcagcggtcatttcagatgtgattcatctaaatggtgccatgataatggcgtgaactac
aagattggcgacaagtgggatcgccaaggagagaatggacagatgatgagctgcacctgt
cttggaaatggaaaaggagaattcaagtgtgatcctcatgaggccacatgttatgatgat
ggaaagacataccatgtaggggaacagtggcaaaaggagtacctcggggccatctgctct
tgcacatgttttggtggacagcagggatggcgttgtgacaactgccgcaggcctggggta
gagacggcacctgaaggctcagcaggccattcctactcccagtattctcagagataccat
cagagaacaaatactaatgtcaactgcccaattgagtgtttcatgcctttggatgtacag
gcagacacagaaaattcacgagattccctagaaaagtaa

KEGG   Sarcophilus harrisii (Tasmanian devil): 100929086
Entry
100929086         CDS       T02286                                 

Gene name
LAMB1
Definition
(RefSeq) laminin subunit beta-1
  KO
K05636  laminin, beta 1
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr04151  PI3K-Akt signaling pathway
shr04510  Focal adhesion
shr04512  ECM-receptor interaction
shr05145  Toxoplasmosis
shr05146  Amoebiasis
shr05165  Human papillomavirus infection
shr05200  Pathways in cancer
shr05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:shr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100929086 (LAMB1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100929086 (LAMB1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100929086 (LAMB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100929086 (LAMB1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100929086 (LAMB1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100929086 (LAMB1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100929086 (LAMB1)
   05145 Toxoplasmosis
    100929086 (LAMB1)
SSDB
Motif
Pfam: Laminin_EGF Laminin_N F5_F8_type_C CorA
Other DBs
NCBI-GeneID: 100929086
NCBI-ProteinID: XP_023360562
Ensembl: ENSSHAG00000004532
LinkDB
Position
5
AA seq 1788 aa
MGLLQVHLFGFLVSALWGVYVHAQEPEYSYGCAEGSCYPATGDLLIGRAQKLSVTSTCGL
HKPEPYCIVSHLQEDKKCFICNSQDPYHETFNPDSHLIENVVTTFAPNRLKIWWQSENGV
ENVTIQLDLEAEFHFTHLIMTFKTFRPAAMLIERSSDFGKTWGVYRYFAYDCESSFPGVS
TGPMKKVDDIICDSRYSDIEPSTEGEVIFRALDPAFKIEDPYSPRIQNLLKITNLRIKFV
KLHTLGDNLLDSRMEIREKYYYAVYDMVVRGNCFCYGHASECAPVDGHNEEVEGMVHGHC
MCRHNTKGLNCELCMDFYHDLPWRPAEGRNSNACKKCNCNEHSGSCHFDMAVYLATGNIS
GGVCDDCQHNTMGRNCEQCKPFYYQHPERDIRDPNICEACTCDPAGSQNGGICDSYTDFS
AGLIAGQCRCKLYTEGEKCDICKEGFYGLSADDPFGCQSCACNPLGTIPGGNPCDSETGY
CYCKRLVTGQHCDQCLQEHWGLSNDLDGCRPCDCDVGGSLNNNCSAESGQCLCRSHMIGR
QCNEVESGYYFTTLDHYIYEAEEAHFGPGVSIVERQYIQDRIPSWTGAGFVRVPEGAYLE
FFIDNIPYSMEYDILIRYEPQLPDHWEKAVITVQRPGRIPTSSRCGNTVPDDDNQVVSLS
PGSRYVVLPRPVCFEKGVNYTVRLELPQYTSSDAGVESPYTLIDSLVLMPYCKSLDIFTV
GGSGDGVITNSAWETFQRYRCLENSRSVVKTPMTDVCRNIIFSISALLHQTGLACECDPQ
GSLSSVCDPNGGQCQCRPNVVGRTCNRCAPGTFGFGPNGCKPCDCHMQGSINAFCDPVTG
QCHCFQGVYARQCDRCLPGYWGFPNCQPCQCNGHADDCDPISGECFGCQDYTSGHNCERC
LPGYYGDPIIGSGDHCRPCPCPDGPESGRQFANTCYQDPITLQLVCVCNPGYLGARCDEC
ASGYFGNPGDVGGVCQPCQCHNNIDTTDPESCDKGTGRCLKCLYHTEGENCQLCKFGYYG
DALRQDCRKCVCNYLGTVQEHCDGSDCQCDKITGQCLCLPNVIGQNCDHCAPNTWNLASG
MGCEPCSCDAAHSFGPSCNEFTGQCQCMPGFGGRTCNECQELFWGDPNVECQACDCDPRG
IETRQCDQSTGQCVCIEGVEGTRCDKCTRGYSGIFPDCTPCHQCFALWDVIISELTNRTH
KFLEKAKALKISGVIGPYRETVDSVERKVNEIKSILAQSPAAEPLKNIGNLFEEAEKLTK
DVTEKMSEVEANLSDTASKSNSTVQELDSLQMDAQSLDKTVKELAEQLEFIKNSDIRGAL
DSITKFFQMSLEAEERVNASTTDPNSTVEQSSLTRNKVEDLMMEREAQFREKQEEQSRLL
DELAGKLQSLDLSAVAEETCGTPPGASCAETPCGGPNCRTDDGEKKCGGPGCDGLVTVAH
NAWQKAMDFDRDVLSALAEVEQLSKTVSEAKLRADEAKQSAQAVLLKTNATKEKVDKSNE
DLRNLIKQIRNFLTQDSADLDSIEAVANEVLKMEMPSTPQQLQNLTEDIRERVESLSQVE
VILQQSAGDIARAEMLLDEAKRASKSASDVKDTADMVKEALEEAEKAQIAAEKAIKQADE
DIQGTQNLLTSIESETAASEETLYNASQRISELEKNVEELKRKAAQNAGEADYIGQVVNT
VKQSADDVKKVLDSELSGKYKRVENLIAKKTEESADARKKAEMLQNEAKMLLAQANSKLQ
LLKDLEQKYEDNQKYLEDKAQELVKLEEEVRFLLQDISQKVAVYSTCL
NT seq 5367 nt   +upstreamnt  +downstreamnt
atgggattactccaggtgcaccttttcggtttcctagtctcagctctctggggagtctac
gtgcacgcccaagaacccgagtacagttatggctgtgccgagggcagctgctatccagcc
acgggagacctgctgattggccgagcccagaaactctcagtgacctccacgtgcggactg
cacaaacctgagccctactgcatcgtcagccacctccaggaggacaaaaaatgtttcata
tgcaattctcaggatccttaccatgagacattcaaccctgatagtcatctcattgaaaat
gtggttacaacatttgctccaaaccgcctcaagatttggtggcaatctgagaatggtgtg
gagaatgttactatccagctggatttggaagctgaattccatttcactcatctcatcatg
actttcaagacattccggcctgctgcaatgctgatagaaagatcatctgactttggcaaa
acttggggcgtgtacagatactttgcatacgactgtgagagttcattcccaggtgtttca
actggaccaatgaaaaaagtggatgatattatctgtgattctcgctactctgacattgag
ccttcaactgaaggagaggtgatattccgtgctcttgatcctgctttcaaaatagaagat
ccttatagtccaagaattcagaacctcttaaaaatcaccaacttaagaatcaagttcgtc
aagttgcacactttgggagacaacctgttggattccagaatggaaatcagagaaaaatac
tattatgcagtttatgacatggtggtccgtggaaattgcttctgttatggacatgccagt
gaatgtgctccagtagatggtcataatgaagaagttgaaggaatggtacatggacactgc
atgtgcaggcataataccaaaggtttaaactgtgaattgtgtatggacttctaccatgat
ttaccatggaggccagctgaaggtcgtaacagtaacgcatgcaaaaaatgtaactgcaat
gagcactctggctcatgtcacttcgatatggccgtttacttggcaacgggcaacatcagt
ggaggagtgtgtgatgattgccaacataacacaatgggacggaactgtgaacaatgcaaa
cctttttactatcagcatccagagagagatatccgagacccaaatatctgtgaagcatgt
acctgtgacccagctggttctcaaaatggtggaatttgtgatagctacactgatttctct
gctggcctcattgctgggcagtgtcggtgtaaattatacacagaaggagagaagtgtgat
atttgcaaagaaggtttctatggattaagtgctgatgatccatttgggtgtcagtcctgt
gcttgcaaccccttgggaactatccctggagggaatccttgtgactccgagacaggatat
tgctactgtaaacggcttgtgacaggacaacattgtgaccagtgtctgcaagaacactgg
ggtttaagcaatgatctggatgggtgtcgaccttgtgactgtgatgtagggggatcatta
aacaataattgctcagcagaatcaggccagtgcttgtgcaggtcccatatgatcggtcgg
cagtgcaatgaagtggaatctggttattacttcacaactctggatcattacatttatgag
gcagaagaagctcactttggtcctggagtcagcatagtggagaggcagtatattcaagat
cgcataccttcctggactggagctggctttgtcagagtacccgagggagcctatttggaa
tttttcatcgacaacattccatattccatggaatatgacatccttattcgctatgaacca
cagttgccagatcactgggaaaaagctgtcatcactgtacagcgtcctggaagaattccc
acaagtagccgatgtggtaacaccgttcctgatgatgacaaccaggttgtatcattgtcg
ccgggatccagatatgtagtccttccacgtcctgtgtgctttgagaaaggtgtgaactac
acagtgcggttggaattacctcagtacacttcctctgatgctggagtagagagcccatat
accctcattgattctctggttctcatgccgtactgtaaatccttggatatattcactgtt
ggaggctcaggagatggtgtgatcactaacagtgcttgggagacctttcaaagataccgg
tgtttggagaatagcagaagtgtggtgaaaacccccatgacagatgtgtgtaggaacatt
atctttagcatttctgccctgctacaccagacaggactggcttgtgaatgtgatcctcag
ggatccttaagttctgtctgtgaccctaatggaggtcagtgccaatgccgccctaatgtt
gttggaagaacatgcaacagatgtgctccgggcacttttggatttggccctaatggatgc
aaaccttgtgactgccacatgcaaggttccatcaatgccttctgtgacccagttactggc
cagtgtcactgtttccaaggggtctatgcccggcagtgtgaccgatgcctcccaggttat
tggggctttccaaactgccagccttgtcagtgtaacgggcatgcagatgattgtgatccc
atttcaggagaatgttttggctgtcaggactacacttcaggtcataactgtgaaaggtgc
ttgcctggctattatggagaccctatcattggttcaggagatcactgtcggccctgccca
tgcccagatggtccagaaagtggacgacagtttgctaatacctgttatcaagatcctatt
actttgcagcttgtgtgtgtttgcaatcctggatacctaggagccagatgtgatgagtgt
gcctcgggctactttgggaaccctggagatgttggtggggtttgccaaccatgtcagtgc
cataacaatatcgacacaactgacccagaatcctgtgacaaagggactggaaggtgcctc
aagtgtctatatcatactgagggtgaaaactgccagctttgcaaatttgggtattatgga
gacgcacttcgacaggattgtagaaaatgtgtttgtaattatctgggtacggtccaggag
cactgtgatggctctgactgtcaatgtgacaagataactggtcaatgcctgtgccttcca
aatgtgattgggcagaactgtgatcactgtgcacccaacacctggaacctggccagtggt
atgggatgtgaaccttgcagctgtgatgctgcccattcttttggcccatcctgcaatgag
ttcactgggcagtgtcaatgcatgcccggctttggaggtcgaacttgtaatgagtgccaa
gagctgttctggggagatccaaatgtggagtgccaagcttgtgactgtgaccccagaggg
atcgagacacgtcagtgtgaccagtccacaggccagtgtgtttgcattgaaggtgtggag
ggaacacgctgtgacaagtgcacccgtggatattcaggcatcttccctgattgcactccc
tgccaccagtgctttgcattatgggatgtcatcatctctgagttgaccaacaggactcac
aaattcctggagaaagctaaggctttgaaaatcagtggtgtgattggaccttaccgagag
acagttgactctgtggaaaggaaagtcaatgagataaaaagtatacttgcccagagccca
gctgcagaacccctgaagaacattggaaatctctttgaggaggcagagaagctaaccaaa
gatgttacagaaaaaatgtcagaggttgaagcaaatttgtctgacacagcctcaaaaagt
aacagcacagtccaagagctggattccctgcaaatggatgcacagagtttggacaaaaca
gtaaaagaacttgctgaacaactggagtttatcaaaaactcagacattcgtggagctttg
gacagtattaccaaattttttcagatgtctcttgaggcagaggaaagagtgaatgcttcc
accacagatcccaatagcactgtagaacagtcctcccttactcgaaacaaagtggaagac
ttaatgatggaaagagaggcccagttcagggaaaaacaggaggaacagtctcgccttcta
gatgaacttgcaggcaaattacagagtttggatctttctgcagtagctgaagagacttgt
ggaactcctccaggggcttcttgtgctgagacaccatgtggagggccaaactgcaggaca
gatgatggggaaaagaagtgtggtgggcctggttgtgatggcttggtcactgtggcacat
aatgcctggcagaaggccatggacttcgacagagatgtcctcagtgccctggccgaggtg
gaacaactctcaaagacggtctctgaagctaaactaagggcagatgaagcaaaacaaagt
gcccaggcagttctactgaaaactaatgccaccaaagaaaaagtggacaagagcaatgag
gatctgaggaatctgatcaagcaaattcgaaactttctaactcaggacagtgctgatctg
gatagcattgaggctgtggctaatgaagtactgaagatggagatgccaagcactccacag
cagctacagaacctaaccgaagatattcgggaacgagtagaaagcctttcccaagtggaa
gtcatcctacagcaaagtgctggggacattgccagagcagagatgctcttagacgaagca
aagagagccagcaaaagcgcttcagatgttaaagacactgcagacatggtcaaagaagcc
ctggaagaagcagaaaaggctcagattgctgcagaaaaggccattaagcaagcagatgaa
gacatccaaggaactcagaacctactgacttcaattgagtctgaaactgcagcatctgag
gaaacgttatacaatgcctctcagcgcataagcgagttggaaaagaacgtggaagaactt
aagcgcaaagctgcccagaacgctggggaggccgactacattggacaagtagtgaatact
gtaaaacaaagtgcagatgatgttaagaaggtccttgacagtgaacttagtggaaagtat
aaaagagtggaaaacctaatagccaagaaaacagaagaatcagctgatgccagaaagaaa
gcagaaatgctacaaaatgaagctaaaatgctgcttgcccaagcaaacagcaagctgcaa
cttttgaaggatttggagcaaaaatatgaagataatcaaaaatatctagaggataaagct
caagaattggtgaaactagaagaagaagtccgttttcttctacaggatataagccaaaaa
gttgctgtttatagcacttgtttgtaa

KEGG   Sarcophilus harrisii (Tasmanian devil): 100930114
Entry
100930114         CDS       T02286                                 

Gene name
LAMB4
Definition
(RefSeq) laminin subunit beta-4 isoform X1
  KO
K06245  laminin, beta 4
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr04151  PI3K-Akt signaling pathway
shr04510  Focal adhesion
shr04512  ECM-receptor interaction
shr05145  Toxoplasmosis
shr05146  Amoebiasis
shr05165  Human papillomavirus infection
shr05200  Pathways in cancer
shr05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:shr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100930114 (LAMB4)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100930114 (LAMB4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100930114 (LAMB4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100930114 (LAMB4)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100930114 (LAMB4)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100930114 (LAMB4)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100930114 (LAMB4)
   05145 Toxoplasmosis
    100930114 (LAMB4)
SSDB
Motif
Pfam: Laminin_EGF Laminin_N Laminin_II
Other DBs
NCBI-GeneID: 100930114
NCBI-ProteinID: XP_023360546
Ensembl: ENSSHAG00000006366
LinkDB
Position
5
AA seq 1796 aa
MKFHLTFFMHLVLFRLSKAQDECISGSCHPIVGDLLLGRSAQLTASSTCGLDGPQKYCII
GYLEGEQKCFICDSRYPYNPYTQANSHTIENVITTFESDRKKKWWQSENGLDNVSIRLDL
ETLFQFSHLIMTFKTFRPAAMLVERSVDYGQTWKIFRYFAKDCATSFPNIPSGQAQGVDD
LVCDSKYSDIEPSTEGEVVLKALDPSFEIENPYSPYIKDLVTLTNLRINFTKLHTLGDTL
LGRRPNDPLDKYYYALYDMVVRGRCFCNGHANKCGPTQDVRGDVFSPPGMVHGHCICQHN
TDGPNCERCKEFFHDVPWRPAEGLQDNACRSCNCNGHSERCHFDMSLYLSSNSVSGGVCE
DCQHNTMGQHCDQCKPLFYRDPFKEISDPHACIPCECDPEGSLSGGMCESYPDPVLGIEA
GQCFCKDNVEGPQCDQCKSGYYGLNANDPLGCQSCNCNPLGSVPFSTCDVVTGQCLCQQF
ATGPQCDECLVGYWGLKNNLHSCSPCDCDIGGAYSNLCSPNDGQCECRPHVIGHQCTEPE
PGYFFVPLDFYIYEAEDAMPISGSAPLILATALPECEVYFHKQEGSFTIDSGNIVLERNK
IQSSREQSEVTSTFDHVVIKDPILGKPVTWTGLGFSQVLSGTNLRFTINNIPYATNYAVA
ISYEPQSSADWTARMEILPSGPSRSEYCRHKAHLQEPQTLTLPASGRIALFATPVCLEPG
IQYSIDVHFSQPFIMNSQTHGHILIDSLGLIPQIDSVENFCSKHLDEHQVNNCIEIASKP
HHQILPDWCERLVVSISARIHNGAVACKCHPQGSIGSSCSKVGGQCQCKPHVTGRCCDRC
STGAYGLGHHGCHPCECHPQGSKSTICDQITGQCSCHRDIGGHRCDLCLPGYFGFPNCRP
CPCNGFAELCDPETGSCFNCRGFTAGLHCERCIDGYYGNPLSGKPCLPCQCPDVPSSNQY
FAHSCYQNSWNLEVICNCQEGYTGIQCDECSSGFYGNPKISGDLCLPCVCNNNIDGADPA
SCSRVTGECLKCLYNTHGPNCQFCKPGYFGSALTQNCRKCTCNPSGVNHTACAIGDTECL
CDPTTGSCPCLPNVIGLTCDQCAEGYWNLVPRRGCQICECDPQHSHSTHCDQFTGQCPCK
LGYGGKHCNKCEENYYGDPQVQCIECKCNKEGTQTAICDQETGSCLCRAGVMGHFCDRCA
RGHFQEFPTCLRCPLCFDQWDNEISSLSEAVQGLIRLAANLEDKRETLPGCNADFKRLED
SMSEAERIWKHPVFSSGEFLNVKDYHDSVRTQVDQISQQVNREYDFQDLNGTLVGIGKEV
DDLLEDLQKKVHLASHVSNSSIRDTSMIEKYYQMSLSAEQKINDTIFIIKQSENTKNDLL
TMIAGLTSKVNFSREKLKQIQTPDIQKLNEKVCGTPGNLSCILSPCGGALCKDADEHRIC
GGPNCNGSLSLSRDAAKRAEETDSMINNLTNQLQLSENQIRNITKLTQLTKTKALQLTEK
LESMKDQIEPEEQRIKALIHKAKDFLLDENVPPEDIEKVANHVLDLNLPITSQNLTKELD
KIDLLMKLCEDDQASGSSLKLKVTETQTLLEKSKDAEETVNTLEEMLKNLKGAESIQRQT
NSVVKQLTDEIQKMEMTILKAENFTNKTEGELEHISSQQSTLEDEISNLQTKILRTRDQA
FSVKAQAESAQDQANITEKDFIDLKKQFTILQNKTNAKGSKKGTLSKVKQLKEEAEKLAG
ETEEKMQRIKDLEKKIQVLNQAKQEKVNQLKQLENHVLAIKNEITTQENKYSTCHI
NT seq 5391 nt   +upstreamnt  +downstreamnt
atgaaatttcatctgaccttttttatgcatcttgtgctttttaggctctcaaaagctcaa
gatgagtgcatcagtggctcttgtcatccaattgttggtgatctcctactgggtcgcagt
gcccagcttacagcctcctctacctgtggattggatggaccacagaaatattgcatcata
ggctacttggagggtgaacaaaaatgtttcatttgtgattctagatatccatataatcca
tatacacaagccaacagccatacaatcgagaatgtcattacaacatttgaatcagataga
aaaaagaaatggtggcaatctgaaaatggtcttgataatgtcagcatcagactggaccta
gagacactgtttcagttcagccatcttataatgacttttaagacattccgacctgcagcc
atgttggttgagcgttctgtggactatggccaaacgtggaaaatttttagatattttgca
aaagactgtgctacatcttttcccaacatcccctctggccaagcacaaggagtagatgac
cttgtttgcgattccaagtattctgatattgagccctctactgaaggagaggttgtttta
aaagctttggatcccagctttgaaatagaaaatccctacagcccctacataaaggatcta
gtgactctaacaaatctaaggataaactttaccaaactacacactttgggggatacattg
cttggaagaagaccaaatgatccccttgataagtattactatgctctctatgatatggtt
gttcggggaagatgcttttgcaatggtcatgctaacaaatgtggccccacacaggatgtc
cggggagatgtcttcagcccacctggaatggttcatggtcactgtatctgccagcacaat
acagatggtccaaactgtgagagatgcaaggaattctttcatgatgttccctggaggcca
gctgaaggtctccaggataatgcttgcagatcatgtaattgtaatggtcactcggaacgc
tgtcactttgatatgtctctgtacctctcaagtaacagtgtcagcggtggagtgtgtgaa
gactgtcagcacaatactatgggacaacattgtgatcagtgcaaacccctgttttacaga
gaccccttcaaagaaatttcagatccccatgcttgcattccttgtgaatgtgatcctgaa
gggtcattgtctggtggtatgtgtgaaagttatccagatccagtcctgggaattgaggct
ggtcaatgcttttgtaaagataacgttgaaggacctcaatgtgaccagtgcaagtctggg
tattatggactgaatgccaatgatcctctgggttgtcaatcctgcaattgtaaccccctt
ggaagtgtaccattctctacctgtgatgtggttactggccaatgcttgtgccaacagttt
gctactggaccccagtgtgatgaatgtcttgttggatattggggacttaaaaataatcta
cacagttgttctccttgtgactgtgatattgggggtgcttatagcaacctgtgttcccct
aatgatgggcaatgtgaatgtcgtcctcacgttatcggccatcaatgcacagaaccagaa
cctggatatttctttgtgcctttggatttctatatatatgaagctgaggatgccatgccc
atctctggatctgcacctttgatactagcaacagccttacctgaatgtgaagtgtatttc
cacaagcaagaagggagtttcacaattgacagtggaaatatagttttggaaaggaataaa
atacaaagttcacgggaacagagtgaagtcactagcacttttgatcatgttgtcatcaaa
gatcctattcttggaaaacctgttacgtggacagggcttggattttcccaggttctcagt
gggaccaacttgagattcaccatcaacaatattccctatgctacaaactatgctgttgca
attagttatgagcctcagtcttcagctgactggacagcccgcatggagattctcccttct
ggaccttcaagaagtgaatattgcagacataaagcacacctacaagagcctcagactctg
accttaccagcttctgggagaatagcactatttgccacaccagtctgtctagaaccaggc
atacagtattctatagatgttcatttttctcagccatttattatgaattcacagactcat
ggacatattttgattgattcgcttggccttattcctcaaattgattcagtagagaatttc
tgcagtaaacatttagatgagcaccaagtaaacaactgtatagaaattgcttcgaaacct
catcatcaaattttgcctgactggtgtgaaagacttgtagttagcatatctgctaggata
cacaatggagcagttgcctgtaagtgtcaccctcagggctccatagggtcaagctgcagc
aaagtgggaggccagtgtcaatgtaaaccccatgtgactggacgctgctgtgatcggtgt
tccacaggagcctatggtttgggccatcatggatgtcacccatgtgagtgccatcctcaa
ggctccaagagtaccatatgtgatcagataacagggcagtgctcctgccacagggacatt
ggaggtcatcgctgtgatctgtgcttacctggttattttggatttcccaattgccgtcct
tgtccttgcaatggttttgcagaactttgtgacccagagactgggtcatgcttcaactgc
agaggatttacagctggacttcattgtgaaaggtgcatcgatggttactatggaaatcct
ctctctggaaaaccatgtcttccttgccagtgtcctgatgttccttcaagtaatcagtat
tttgcccattcctgttatcagaattcttggaatttagaagtaatctgcaactgtcaggag
ggttatacaggtattcagtgtgatgaatgctcaagtggtttttatggaaatccaaaaata
tcaggagacctttgcctgccatgtgtttgcaacaacaatatagatggagcagacccagca
tcctgcagcagggtaacaggagaatgccttaaatgtttatataatactcatgggcctaac
tgccagttctgtaaaccaggttactttggatcagcactcacacaaaactgcagaaaatgt
acttgcaatccttctggggtaaatcatacggcatgtgcaataggtgatacagaatgccta
tgtgacccaacaacaggatcctgtccttgcttgccaaatgtcataggtttgacctgtgac
caatgtgccgaaggatactggaatctggtccctaggagagggtgtcagatctgtgaatgt
gacccccaacattctcacagtactcattgtgaccagtttacaggccaatgcccttgtaaa
ttgggctatggtggaaaacactgcaacaaatgtgaggaaaattactatggagatccccag
gtgcaatgcattgaatgtaagtgtaataaggaaggaacacaaacagccatctgtgaccag
gaaactggttcctgcctgtgccgagcaggtgtcatgggccacttctgtgatcgttgtgcc
cggggtcatttccaggaatttcccacctgtcttcggtgtcccttgtgctttgatcaatgg
gacaatgagatttcttccctctctgaggctgtacaagggttaattaggttggctgcaaac
ttggaagataaaagagagaccctgcctggctgcaatgcagacttcaaacgcctagaagat
agcatgtctgaagcagagaggatttggaaacatcctgttttctcatctggggaattctta
aacgtcaaggattatcatgattctgttagaacacaggttgaccagataagtcaacaagtg
aatagagagtatgacttccaagatctgaatggaactttggtgggcattgggaaagaagtg
gatgatctactcgaagacttgcagaaaaaagtacacttggcctcccatgtcagcaattcc
agcatcagggatacctcaatgatcgagaaatattatcaaatgtcattatctgcagaacag
aaaattaatgataccatatttatcataaaacaatctgaaaataccaagaatgatttactt
actatgatagctggactaacctcaaaagtaaacttctcacgggaaaaattaaaacagatc
cagacaccagatatccaaaaattgaatgaaaaggtgtgtggaactccaggtaacttgtca
tgtattctttcgccctgtgggggagctctgtgtaaagatgcagatgagcacaggatttgt
ggaggtccaaactgtaatggttccctatccctttcaagggatgctgccaagagagctgag
gaaactgactctatgattaataatttgactaatcagctacaactatcagagaatcagata
agaaacataacaaaactaactcaacttactaagaccaaagccttgcagctaactgagaag
ctagagagtatgaaagaccaaatagagccagaagaacagaggataaaagccctcatccac
aaagcaaaggactttttgctagatgagaacgttccaccggaagacatagaaaaggttgca
aatcatgtccttgatctcaaccttccaataacttcacaaaatctaactaaagagcttgac
aaaatagatttgcttatgaaactctgtgaggacgaccaagcatcagggagcagcttaaaa
ctaaaagtcacagaaacacagacgcttttagagaaatctaaagatgccgaggaaactgtg
aacaccctggaagaaatgctgaaaaacttgaaaggtgctgaaagcatccaaagacaaaca
aactctgttgttaaacagctgactgatgagatacaaaaaatggaaatgacgatactgaag
gctgaaaatttcaccaataagacagaaggtgagctggaacacatatcaagccaacagtct
acactagaagatgaaatctctaacctgcaaaccaagatactaaggactcgagaccaggct
ttcagtgtgaaagcccaggcagaatcagctcaggatcaagctaatatcactgagaaggat
ttcattgacctaaaaaaacaatttacaattcttcaaaataagacaaacgctaaaggatcc
aagaaaggaacactcagtaaagtaaagcagctaaaagaagaagcagaaaaattggcagga
gagacagaggaaaaaatgcaacgaataaaagatttagaaaagaagatccaagtcttgaat
caagctaaacaagagaaagtcaatcaactaaagcaactagaaaatcatgttctagctatt
aaaaatgaaattaccacccaagaaaataaatattctacttgccacatctag

KEGG   Sarcophilus harrisii (Tasmanian devil): 100931469
Entry
100931469         CDS       T02286                                 

Definition
(RefSeq) laminin subunit beta-2
  KO
K06243  laminin, beta 2
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr04151  PI3K-Akt signaling pathway
shr04510  Focal adhesion
shr04512  ECM-receptor interaction
shr05145  Toxoplasmosis
shr05146  Amoebiasis
shr05165  Human papillomavirus infection
shr05200  Pathways in cancer
shr05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:shr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100931469
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100931469
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100931469
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100931469
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100931469
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100931469
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100931469
   05145 Toxoplasmosis
    100931469
SSDB
Motif
Pfam: Laminin_EGF Laminin_N F5_F8_type_C
Other DBs
NCBI-GeneID: 100931469
NCBI-ProteinID: XP_031815263
Ensembl: ENSSHAG00000015322
LinkDB
Position
1
AA seq 1794 aa
MRLILGHQGWGLGGLELWLLLVLIVLAKAPAQNPDLPSAGCSRGSCYPATGDLLVGRADR
LTASSTCGLRGPEPYCIVSHLQDEKKCFLCDSRHPFSARHPQSHRIQNVVTSFAPQRRSA
WWQSENGVSTVTIQLDLEAEFHFTHLIMTFKTFRPAAMLVERSSDFGRTWRVYRYFSYDC
GSDFPGVPLAPPHRVDDVVCESRYSEIEPSTEGEVIYRVLDPAIPITDPYSPRIQDLLKI
TNLRVNLTRLHTLGDNLLDPRREIREKYYYALYELVVRGNCFCYGHASQCARAPGAPAHA
EGMVHGACVCKHNTRGLNCESCQDFYHDLPWRPAEDGRPHACKRCECHQHARSCHFDMAV
FLASGNTSGGVCEDCQHNTAGRRCELCRPFYFRDPARDLRDPAACRPCDCDPAGARDGGL
CDPHDDPALGLVSGQCRCKEHVAGPRCQRCRDGYFGLSAADPQGCQRCQCDPRGTVPGGP
PCDAGSGACFCKRLVTGRHCERCLADHWGLSHDLLGCRPCDCDVGGALEPRCAEDSGQCR
CRRHMFGRRCDQVQPGYFLPFLDHLTFEAEAARGQALDIIERMAHPGMAASWTGVGFVRL
REGQTLEFVVATVSQAMDYELLLRYEPQVPEQWAEVTLTVQRPGPISPSSPCGTTVPEDD
HFRGMLQPGTRYVLLPSPVCLEPGLSYTIRLELSRAGGDVRPGAPPPGLLFDSLVLVPRW
ASLEMFSAGDAGALERRATFERYRCHEEGLTPAKSPPVEACAPLLRSLAALVYDGALACQ
CDPQGSLSSECQAHGGQCPCKPHVTGRRCDRCAPGTFGFGPSGCRACQCSPEGSLSSLCH
EASGQCPCRPGAFGPRCDRCQPGQWGFPSCRPCHCNGHADDCDPRTGSCQSCRDHTAGDH
CERCMAGFYGNPVLASGGHCRPCPCPEGPGGQRHFATSCHQDRHSQQVICHCQPGYTGPR
CEECAPGHFGDPLRPGGRCQPCECSSNIDPMDPEACDRQTGQCLRCLHNSEGPRCAHCRL
GYYGQAAHQSCRRCTCNFLGTERSQCPSQDKCRCDPGSGQCPCLPNIQGQSCDRCAPNFW
NLASGQGCQPCSCHPSHATSPSCNEFTGQCHCRAGFGGRTCTECQENHWGDPGLQCRACD
CDSRGIETPQCHHATGHCVCRPGVAGVRCDQCARGFSGVFPACQPCHACFGDWDRIVQGL
ASRTRALEQRARELHQLGALGAFEKNFRLLGEKLGTVQGIVNARNATAAATLQLMAITED
LRHDIEEATGQLTKLEGELTEAQDENFNANHALSGLERDGRALNLTLRQLGQHLDVLKHS
NFLGAYDSIRQSHAQSSEAEHRANRSALAVPGPVSDSAATRRRAEGLMGSQRDSFDRRNV
ANRRALGELAAKANSLSLTGINELVCGAPGDAPCATSPCGGAGCRDEDGQRRCGGLNCQG
AAATADNALGRARHTQEELRRTLGDADGLVGKVAEARLQAGVARQRAQAALEKANETRDR
VERANQELRELIQNVKDFLSQEGADPGSIEAVATHVLELSIPASPAQIHHLANEIAERVR
SLGDVDTILQRTAGDVRQAEQLLQDAQQARTRAQSEKQKAEMVQDALEEARRAQGAAKGA
IRGAAADTEGTEQTLGRVREKTAGAERDLSMATERTERLDAQLDALKLKRAGNSLEATRA
EETANSAQGRAQEAEQLLKGQLGDRYQTVRDLADRKAQGVLQAKERAERLRDEARGLLQD
AQDKLRRLHELEGTYEVNERALEGKAAQLDGLEAKMKDVLQSINQQIQIYNTCQ
NT seq 5385 nt   +upstreamnt  +downstreamnt
atgaggctgatcttggggcaccaagggtggggcctagggggactggagctgtggctgctg
ctggtcctaatcgtgttggccaaggccccggcccagaaccccgacctgccttcagccggt
tgttccaggggaagctgctacccggccactggcgatctcctggttggcagagcagacaga
ctgacagcctcgtccacctgcgggctcagaggccctgagccctactgtatagtcagccac
ctacaggatgaaaaaaagtgtttcctgtgcgactctcggcatccattctctgcccgccac
cctcaaagccaccgaatccagaacgtggtcaccagctttgccccccaacggcggtcagcc
tggtggcaatcagaaaatggagtgtccaccgtcactatccagctggacttagaggctgaa
ttccattttacccaccttattatgaccttcaagacgttccggccagccgcgatgctggtg
gagcgctcctcagacttcgggaggacctggcgggtctatcgctatttctcctacgactgt
ggctctgacttccctggggtccctctggcccccccccatcgcgtggatgacgtggtctgc
gagtctcgatactcagaaattgagccctccaccgagggggaggtcatctaccgcgtcctg
gacccggccatccccatcaccgatccctacagtccccggatccaggacctcctgaagatc
accaaccttcgggtgaacttgacacggcttcatactttgggggacaacctgctggacccc
cggagggagatccgggagaaatactattatgccctctacgagctggtggtccggggaaac
tgcttctgctacggccacgcgtcccagtgtgcccgggctcccggtgcccccgcccacgcc
gagggcatggtacacggagcctgtgtgtgcaaacacaacacccgcggcctcaactgcgag
agctgccaggacttctaccacgacctgccctggcgcccagccgaggacggccgcccccac
gcttgtaaaaggtgcgagtgccaccagcacgcccggagctgccactttgacatggccgtg
tttctggcctcggggaacacgagcggaggcgtgtgtgaggactgccagcacaacacggcc
ggccgccgctgcgagctctgccgccccttctacttccgggaccctgcgagggacctgcgg
gacccggccgcctgccgcccctgtgactgtgaccctgcgggcgcccgcgacggcggcctc
tgtgacccccacgatgaccccgccctggggcttgtgtccggccagtgtcgctgcaaggag
cacgtggccggcccccgctgccagcgctgccgagacggctacttcggcctgagcgccgcg
gacccgcagggctgccagaggtgccagtgtgacccccggggcacagtgccggggggccct
ccttgtgacgccggcagcggggcctgcttctgcaaacgcctggtgacgggaaggcactgt
gagcgatgcttggccgatcactggggtctgagccatgacctactcggctgccgcccgtgt
gactgtgatgtgggaggtgctctggaaccccggtgtgctgaggactcggggcagtgtcgg
tgtcgccgacacatgtttgggcgacgctgcgaccaggtgcagcccggatacttcttgcca
ttcttggaccatctcaccttcgaggctgaggccgcccgtgggcaggccctggacataatc
gagagaatggcacacccagggatggcagcctcctggacaggtgtgggctttgtgcggctg
cgggagggtcagaccctcgagtttgtggtggccacggtgtcccaggccatggactacgaa
ctgctcctgcgatatgaacctcaggtcccggagcagtgggcagaggtgactctgactgtg
cagcggccagggcctatatctcccagcagcccctgcggcaccactgtgcctgaggatgac
cacttccgggggatgttgcagcctgggaccagatatgtgctcctgccctctcccgtctgt
ctggagccggggctctcctacacgattcgcctggagctgagccgggctggcggggatgtg
cgccccggagccccccctcccggcctgctctttgactcactggtgctggtgccccgatgg
gcatccctggagatgtttagcgcaggagatgccggtgccctggagagacgggccaccttt
gaacgttaccgctgccacgaggagggcctgacacctgccaagagccccccggtagaagcc
tgtgcccccctcctccgaagcctggctgccctggtgtatgatggagcgctggcctgccag
tgtgacccccagggctccctgagctccgagtgccaggcccacggtgggcagtgtccatgc
aagccccatgtgactgggaggcgctgtgaccgctgcgcgccaggaacctttggctttggt
ccttccggctgcagggcctgccagtgcagtcccgagggcagtctcagcagtctgtgtcac
gaggccagcgggcagtgcccctgccggcctggagcttttgggccacgctgtgatcggtgc
cagccggggcagtgggggttccccagctgccgcccttgtcactgtaacgggcacgcggac
gattgtgacccaaggaccgggtcctgccagagctgccgggaccacacggcgggggaccac
tgtgaaaggtgcatggcaggcttctatgggaacccggtgctggcatcgggaggccactgc
cgcccctgcccttgccccgagggcccaggggggcagcgacactttgctacctcctgccat
caggaccggcactcccagcaagtgatttgccactgccagcctggctacacgggcccacgc
tgtgaggagtgtgcccctggacactttggggacccactgaggccagggggccggtgccag
ccatgtgaatgcagcagcaacatcgatcccatggaccccgaggcctgtgaccgccaaact
gggcagtgtttgcgctgtctccacaactcggaagggcctcgctgtgcccactgtcgcctt
ggatactatgggcaggctgcccaccagagctgccggaggtgcacctgtaattttctgggc
acagagcgcagtcaatgcccttctcaagacaaatgccgctgtgatccaggcagtgggcag
tgcccatgcctacccaacattcagggacagagctgtgaccgttgtgcccccaacttttgg
aacctggcaagtgggcaaggctgccagccctgttcctgtcaccccagccatgctaccagt
ccttcctgcaatgagttcacagggcagtgtcattgccgagcaggctttggaggccgcaca
tgcactgagtgccaggagaaccactggggagatcccggcctgcagtgtcgggcttgtgac
tgtgactcaagaggcattgagacccctcagtgccaccatgccacagggcactgtgtctgc
cggccaggtgtggcaggtgtgcgctgtgaccagtgtgcccgaggcttttcgggggttttc
cctgcatgccagccatgccatgcctgctttggggactgggaccggattgtgcaaggcctg
gcctcgcgcactcgcgctctcgaacagcgagctcgggaattacaccagctgggggccctg
ggggcctttgagaagaatttccgcctgctgggagagaagctgggcactgtgcagggcatt
gtgaatgcccgcaatgccacagctgccgccaccttgcagcttatggccattacagaagac
ttgaggcacgacattgaggaagctacaggacagctgactaagctggaaggagagctgaca
gaggcccaggatgagaacttcaatgccaaccatgcccttagtggattggagcgagatggc
cgagctcttaaccttaccctaaggcagctgggccagcatctggacgtgctgaaacactcc
aacttcctgggggcctatgacagtatccgtcagtcccacgctcagtcatctgaggcggag
catcgtgcaaatcgctcagccctggctgtccctggccctgtgagcgactcagcagctaca
cggcgccgagcagaaggcttgatgggcagccagagagacagctttgaccggaggaatgtg
gccaaccggagggctctgggtgaacttgcagccaaggccaacagccttagcctgacgggc
atcaatgagctggtatgtggggcccctggggatgctccctgtgccacaagcccatgtggt
ggggctggctgcagggatgaggatggacagcgccgctgtgggggcctgaactgtcaagga
gcagcagccacagcagacaatgcactgggccgggcgcggcacacacaggaggaattgcgg
cggaccctgggagatgcagatgggcttgtgggcaaggtggcagaggcaaggctacaagca
ggtgtggcccgacagcgagcacaggcagccctggaaaaggccaatgaaacccgggaccga
gtggaaagggcaaaccaggaacttcgtgaactgattcaaaatgtcaaggacttcttgagt
caagagggagctgaccctggtagcattgaggcagtagccactcatgtgctggagctgtcc
atcccagcatcacctgctcagatccaccatctggcaaatgagattgctgagcgagtacgg
agcctcggggatgtggacaccattctgcagcgcacagcgggggatgtgcgccaggctgag
caacttctgcaagatgcccagcaggcccggacccgggcccaaagtgagaagcagaaggca
gagatggtgcaggatgctcttgaggaagcaagacgggcacagggtgcagcaaaaggcgct
atccgtggggcagccgctgacacggagggcactgagcaaacactgggcagggttcgggag
aagacagctggagcagagcgggatttgagcatggcaacagagcgaaccgagaggttggat
gctcagctggatgctttgaagttgaaaagggctgggaatagcctggaagccacacgggct
gaagagacagctaatagtgcccagggtcgggcccaggaggctgagcagctgctgaagggc
cagctgggtgaccgataccagactgtgagggatcttgctgatcggaaggcccagggtgtc
cttcaggctaaggagagagctgagcgtctacgggatgaggcccggggactgctacaggat
gctcaagacaaacttcggagattgcatgagctggaaggcacatatgaagtgaatgaacgg
gccctggagggcaaagcagctcagttggatggcctggaggccaaaatgaaggatgtcctt
cagtccatcaatcagcagattcagatctacaacacctgtcagtga

KEGG   Sarcophilus harrisii (Tasmanian devil): 100931618
Entry
100931618         CDS       T02286                                 

Gene name
COL4A5
Definition
(RefSeq) collagen alpha-5(IV) chain
  KO
K06237  collagen type IV alpha
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr04151  PI3K-Akt signaling pathway
shr04510  Focal adhesion
shr04512  ECM-receptor interaction
shr04926  Relaxin signaling pathway
shr04933  AGE-RAGE signaling pathway in diabetic complications
shr04974  Protein digestion and absorption
shr05146  Amoebiasis
shr05165  Human papillomavirus infection
shr05200  Pathways in cancer
shr05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:shr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100931618 (COL4A5)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100931618 (COL4A5)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100931618 (COL4A5)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    100931618 (COL4A5)
  09154 Digestive system
   04974 Protein digestion and absorption
    100931618 (COL4A5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100931618 (COL4A5)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100931618 (COL4A5)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100931618 (COL4A5)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100931618 (COL4A5)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100931618 (COL4A5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:shr04147]
    100931618 (COL4A5)
   00536 Glycosaminoglycan binding proteins [BR:shr00536]
    100931618 (COL4A5)
Exosome [BR:shr04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   100931618 (COL4A5)
Glycosaminoglycan binding proteins [BR:shr00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   100931618 (COL4A5)
SSDB
Motif
Pfam: Collagen C4
Other DBs
NCBI-GeneID: 100931618
NCBI-ProteinID: XP_031800822
LinkDB
Position
X
AA seq 1673 aa
MRAAAGLLCFLGLSQWGWPVDAAACHGCSSGPKCDCSSVKGEKGERGLPGLEGHPGLPGF
PGAEGPPGPPGQKGDDGAPGPVGPKGIRGPPGLPGFPGTPGLPGMPGHDGAPGPQGIPGC
NGTKGERGFPGFSGIPGLPGPPGRPGIPGVKGQPGSIILSTALGPKGDPGDPGLPGRQGP
AGMTGSPGPLGSPGLPGWMGPPGPPGIQGPKGNMGLNFQGPKGEKGEQGLQGPPGPPGQI
GEMKRPNETELLKGDQGAPGDQGSPGLPGLQGPPGLPGGVKGEKGWPGEPGQKGKPGRDG
ASGLPGMQGLPGDPGVPGKPGRGGEKGQKGDTGPPGPPGLVLPRGGTGEKGNLGLPGLPG
EKGDQGSPGAPGLPGLPGPPGPTVTGPPGPPGFPGERGEKGAKGLPGVPVPGQPGCDGQP
GAPGLPGTPGKPGPHFPNGAVCEKGARGPPGSPGDRGVPGEQGVKGDKGDTCLNCIEAGL
PGLPGEPGLPGPPGLTGARGFPGQKGAKGNAGAIGPVGSPGLPGVPGASGEPGSKGSPGD
TISFPEMKGDKGDAGLPGASGIPGLPGSPGKDGLPGLPGIKGKPGGFALKGERGPPGKPG
LPGLPGTRGPMGLPGLGLPGPMGKKGIPGMAGNPGPPGIPGAKGDPGPTISQPGPPGLPG
LPGRDGDVGLPGDPGFPGVPGLPGIPGSKGEPGRPGIGLPGPPGPKGYQGMPGPPGTPGA
PGRRGLQGAPGHPGLPGPKGEPGVGLPGPPGLKGLPGVKGAPGPKGSTGFPGLSGIPGLP
GLDGPAGPKGDPGTIGQPGFMGPSGPPGMGRPGHPGPPGVPGSLGQPGLPGHPGGKGDPG
PPGFDVSGPPGERGHPGLPGIPGVMGLQGFPGSPGRDGAPGLSGAKGEMGKLGPPGPPGP
LGIPGRSGVPGLQGENGLPGQPGFPGPVGQKGGKGETGIPGPPGQVDPNYPKVKGEKGDP
GLPGVPGPLGPKGSHGHPGDPGQPGLDGQPGSPGAPGPKGNQGLPGRPGPVGPPGLKGCI
GEMGFPGLQGVQGSPGVPGVAGQPGSPGFPGQNGEKGAPGIGGIGRPGLPGPKGDPGLPG
YPGTPGSQGALGDTGSPGAPGSPGAKGQPGLPGRPGITGLPGPRGMDGPSGSPGIPGQSG
PVGSQGHPGPPGSPGEKGKPGQDGIPGPAGQKGEPGQPGFGLPGPPGISGFPGEKGDEGS
PGTPGSPGPQGPKGERGFPGFPGIQGPPGPPGSPGQNREGPKGNPGPRGHPGRAGPKGPR
GVAGNGRAKGKRGDPGLPGKPGLPGLKGERGPPGPQGDPGWPGFIGMKGNPGIQGIPGFQ
GMKGPPGAPGSAGPAGAPGPRGPSGSPGFPGPSEKDIIIKGDIGPPGLPGLPGLKGPVGI
PGPPGFPGPTGPAGDPGRNGRLGINGPVGPKGDPGPSGQPGNRGVDGSPGSEGLPGLPGP
PGTLSLAHGFLITRHSQTTHIPQCPQGTVQIYTGFSLLYVQGNERAHGQDLGTSGSCLHR
FSTMPFMFCNINNVCNFASRSDYSYWLSTSKPVPMNMEPLSGQSIVPFISRCSVCEAPAM
VIAVHSQTTQLPYCPQDWDSLWTGYSFMMHTSAGAEGAGQTLASPGSCLEEFRPAPFIEC
HGRGTCNYYANSYSFWLATVEASDMFSKPQPETLKAGDLRTRISRCQVCMKRT
NT seq 5022 nt   +upstreamnt  +downstreamnt
atgagggcggccgccggcttgctctgcttcctgggcctgagccagtggggttggcccgtc
gatgcggccgcttgtcatgggtgttcatctggacccaaatgtgactgcagtagcgtaaaa
ggagagaagggagagagaggacttccaggtttggaaggccacccaggtttacctggattt
ccaggagcagaaggaccacctgggcctccaggtcaaaagggtgatgacggtgctcctggg
ccagtgggcccgaagggaatcagggggccccctggacttcctggattcccagggacacca
ggtcttcctggaatgccaggccatgatggagccccaggacctcagggcatcccagggtgc
aatgggacaaaaggagaaaggggatttcccggcttttctggtattcccggtttaccaggt
cccccgggtcgtcctgggattccaggagtgaagggacagccggggagtataattctgtcc
acggcgctgggcccaaagggggacccaggcgatccggggcttccaggaagacaaggtcca
gctggtatgaccggaagcccagggcctctcggttcccctggtctgccaggatggatgggg
cctcctgggccgccaggaattcaaggaccaaaggggaatatgggcttgaatttccagggt
cccaaaggtgaaaagggtgaacaagggctacaaggtccgcctggccccccggggcagatt
ggggaaatgaagagacccaatgagacggagctgctgaaaggagatcagggtgctccgggg
gaccaaggctcacctggacttcccgggctccaggggcctcctggtcttcctggtggtgtg
aaaggtgaaaaaggctggccgggagaaccgggccagaaaggtaagccaggcagagatgga
gccagtggcctcccgggcatgcaaggcttgcctggtgatcccggtgttcctggtaaaccc
ggaaggggaggcgagaagggtcaaaaaggtgacaccggcccccccggcccgcctggactt
gtacttcctcgcggtgggactggtgaaaaagggaacttgggcttgcctggcttgccggga
gagaaaggagatcaaggttccccaggggcaccgggtctacccggccttcctgggcctcca
gggcctactgtcacgggacctcccggaccccctggctttcctggggaaaggggcgagaag
ggagctaaagggctgcccggcgtccccgtacctggccagcccggatgtgacgggcagccc
ggggctcctggtctccctgggactccgggcaaaccgggacctcatttccctaatggtgcg
gtgtgtgaaaagggagctcggggcccaccaggatctccgggggacagaggagtgccggga
gagcaaggagtgaaaggagacaagggggacacctgcctcaactgtatcgaagctggcctc
cctggccttccaggggagcctgggctgccaggacctccaggcctcacaggagctcgtggt
ttccctgggcagaaaggtgccaaaggaaatgccggtgccattggtccagtaggatcacca
ggccttccaggagttccgggtgcctcaggagagcctggttcaaaaggaagtccaggggac
accatcagtttcccagaaatgaagggtgacaaaggtgatgcaggtctccctggagcttca
gggattcctggtttgcctggcagtcccggaaaagatggattgcccggacttcccggcatc
aaaggaaaacctggtggctttgctttgaaaggtgaaaggggtccccctggaaagccaggt
ttgccgggtctgcccgggaccagagggcccatgggtcttcctggtttgggcctaccaggc
cctatgggtaaaaaaggcatcccaggcatggcaggaaatccgggtcccccaggaatccca
ggtgccaaaggtgatcctgggccaactatatcccaaccgggacctcctggcttgcccggc
ctgcctggcagagatggtgatgtgggtcttccaggtgatccagggtttccaggtgtgcca
ggcttgccgggaatccctggcagtaaaggggaaccaggtcgcccaggcattggtcttccc
ggaccaccaggtcccaaaggttaccagggaatgccggggcctccaggaacccccggagca
cctggaagacgtggtctacaaggcgctcctgggcatcctggtctcccaggtccaaagggg
gagccaggggttggccttcctggaccgcctggacttaagggactcccgggcgttaaagga
gcacctggtccaaaaggcagcactggtttcccggggctctcaggcatcccagggctccct
ggtttggatggaccggccgggccaaaaggtgacccgggaacaatcggacagcccggattt
atgggtccttctgggccaccaggaatgggccgtccaggccatccaggaccaccgggggtt
cctggatctcttggtcaaccaggcttgccgggacacccgggaggaaagggagacccagga
ccccctggatttgatgtctcggggcctcccggtgagagaggccatccgggcctccctgga
atacctggggtcatggggcttcaaggttttccagggtccccaggtcgagatggcgccccc
gggctttcaggtgccaaaggtgaaatggggaagctggggcctccaggaccaccgggacct
ttaggaattcctggcaggagtggtgttcctggcttgcaaggtgagaacggtttgccgggt
cagccaggatttcctggtcctgtaggacaaaaaggtggaaaaggcgagactggcattcca
ggccctcctggacaagtggatcccaactatccgaaagtaaagggggagaagggagaccca
ggattaccaggcgttcctggaccgttgggtcccaaaggctcccatggtcatcctggagac
ccaggacaacctggactggatggacagcctggttccccaggagcaccaggccccaaggga
aaccaaggccttcctgggcgaccgggacccgtaggccctcctggattaaaaggctgcata
ggagaaatgggatttccaggtctccaaggtgtgcaagggtccccaggggtgcctggagtt
gccggccagcctggctccccgggatttcctggacaaaacggagagaaaggagcccctggt
attggaggaataggccgcccaggtctcccgggtcctaagggtgatcctggcctgcctggg
tacccagggactcctggcagtcaaggtgccctgggagacaccggttcgcctggtgcccca
gggagccctggggccaaaggacagccaggcttgcccggacggccaggtattacaggcctt
cctggacccagaggtatggatggcccatctggcagccctggtattccaggacaatctggt
cctgtaggcagtcagggccatcctggtcccccaggatctccaggagagaaagggaaaccg
ggtcaagatgggattcctggaccagctggacagaagggtgaaccaggtcaaccaggattt
ggattaccaggacctcccggaatctcaggatttcctggtgagaaaggtgatgaaggttcg
ccaggtactccaggaagccctggacctcaaggccccaagggtgaacggggctttcctggc
tttcctggtatacaaggacccccaggtcctcctggctctccgggtcaaaatcgagaaggt
cccaaagggaaccctgggccccgaggtcatcctgggagagcagggcctaaaggtccccgg
ggtgtcgctggaaatggccgagcgaaaggaaagagaggagatccgggcctacctgggaag
cccggcttgcctggtctcaaaggagaacgaggtccacctgggccccagggcgatcctggg
tggccagggttcattggaatgaaggggaatcctggtatccaaggtatcccgggattccaa
gggatgaagggcccccctggtgctcctggttcagccggccctgcaggggctccaggccct
agaggcccttcaggttcccctggctttcctggtccctctgagaaggatatcatcatcaaa
ggagatattggacctcccggactgccaggcttgccaggattgaaaggtcctgtggggatc
ccaggacccccaggcttcccaggcccaactggaccggcgggagaccctggacgtaatgga
cgccttggcattaatggcccggtaggccccaaaggagacccaggcccatcaggccaacca
ggtaaccgtggagtagatggttctccaggatcagagggcctgccaggtttgccgggtccc
cctggaaccctctctcttgcccatggctttctcatcacacggcacagccagaccacacat
atcccacaatgccctcaaggaaccgtccagatctacacggggttttctctcctttatgta
caaggaaacgagagagcccatggccaagacttggggacatctggcagctgtctgcaccgc
ttcagcaccatgcctttcatgttctgtaacatcaacaacgtatgtaactttgcctcaaga
agtgactactcctactggctgtccacttccaaaccagtgccgatgaatatggagccactg
tcgggacaaagcattgtgccatttatcagtcggtgctcagtgtgtgaagccccggcaatg
gtgattgcagttcacagccagaccacccagctcccctattgcccgcaagactgggattct
ctctggactggttattcctttatgatgcacacgagtgctggggcagagggcgcgggtcag
accctggcctctcctggttcctgtctggaagagttccgtccggcccccttcatcgaatgc
cacggacgggggacttgcaactactacgccaactcctacagcttctggctggcgaccgtg
gaggcatccgacatgttcagtaagccccaaccggagacactcaaagcaggagacttgagg
acacgcataagtcgatgtcaggtttgtatgaaaaggacataa

KEGG   Sarcophilus harrisii (Tasmanian devil): 100934145
Entry
100934145         CDS       T02286                                 

Gene name
LAMA3
Definition
(RefSeq) laminin subunit alpha-3 isoform X1
  KO
K06240  laminin, alpha 3/5
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr04151  PI3K-Akt signaling pathway
shr04510  Focal adhesion
shr04512  ECM-receptor interaction
shr05145  Toxoplasmosis
shr05146  Amoebiasis
shr05165  Human papillomavirus infection
shr05200  Pathways in cancer
shr05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:shr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100934145 (LAMA3)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100934145 (LAMA3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100934145 (LAMA3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100934145 (LAMA3)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100934145 (LAMA3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100934145 (LAMA3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100934145 (LAMA3)
   05145 Toxoplasmosis
    100934145 (LAMA3)
SSDB
Motif
Pfam: Laminin_EGF Laminin_N Laminin_G_2 Laminin_I Laminin_G_1 Laminin_II Laminin_B Laminin_G_3 HBS1_N
Other DBs
NCBI-GeneID: 100934145
NCBI-ProteinID: XP_031802382
Ensembl: ENSSHAG00000008451
LinkDB
Position
1
AA seq 3444 aa
MAGVQKGTPTAAPTPRRFPRLFLLLLFPLSGAAASPEPQTGFSLHPPYFNLAEAARISAT
ATCGEDPGSARPRPELYCKLVGGPIASTTGHTIQGQFCDYCNSGDPNKAHPVTNAIDGTE
RWWQSPPLSLGLQYNKVNVTLDLGQLFHVAYVLIKFANSPRPDLWVLERSVDSGRTYLPW
QFFAHSKIDCWEQFGTDANMPITKDNDVICTTEYSRIVPLENGEVVVSLVNGRPGAKNFT
FSPTLREFTKATNIRLRFLRTNTLLGHLISKAQRDPTVTRRYYYSIKDISIGGRCVCNGH
AEVCRAKGPENLFQCECQHNTCGESCDHCCAGYNQKQWRPATAERTNECEVCNCHGHATD
CYYDPDVERQSESLNIHGVYEGGGVCINCQHNTAGVNCEKCIQGYYRPYNVPVEAPHGCM
PCSCNPENTNGCEEGTGRCFCKSNFQGENCERCAEGFYNFPFCQRIPIYPISTPRPEAST
TAAEIKDGCPPGFFGPQCQACQCYSIGALPGDCDRKTGQCFCQPGFHGFSCEECAVGFFH
YPFCQRCECNPVGVVSEICDFQGKCLCRFGVDGPKCDSCSSGFYSFPACQECNCDPLGSQ
DGACGPRGQCRCYPNYAGLSCTQCAPDYYNYPSCFSCQCSPLGSYQTTCDPVTGQCECRP
GITGQQCDQCLSGAYDFPHCQGFSSECNPAGTIDSSSGYCQCQLYVKGPTCSICKPLYWN
LADENPDGCSECQCDVTGTLSGVGECEQKEGECYCKPHVCGDSCNTCEDGYFALGDSNYF
GCQGCHCDIGGSVSFMCDDLSGACQCREHIMGQSCQQPEDNYYFPDLHHIKFEIEDGMTP
NGRGVRFGFNPLEFPDFSWRGYAQMTPVQNEVRVTLNVEKSNQYLFRAVLRYINPGTETV
FGHINIYRPHSKAGAIQSKEIVFLPSKEPAFVTVPGNGFADPFSLTPGTWTVSIKAEGIL
LDYLVLLPSDYYEASILQLPVTEPCAYSGPIEENCLLYQHLPVTRFACALACEAERFLLN
GMPQVLATRKPTPELPIMADISGREIELHLTLSIPQVDHYVIVLEYTNEDDQLYVADVLV
NTPSPSPAGRVNIYSCKYSFLCRSFVVDDLNRVAVYELLADARIQLKAHFAHFLLHQICI
IPVGEFSTEYVKPSIHCIASYGQFVNQSSSCVLLAHETPPRALVLDALSGGMSPVVPPDP
SPLESVFQGIVLKSPQNQVTLNGRVPHLGQYVFIVHFCQPDHPSFPAQVVVEGGHLWSGS
FSAYFCPQVFGCRNLVIAESQTNLDLSEPEFSVTIKVPDGKSLMLGHVLVVPAENYGYHM
LHKKTVDKSFDFINNCGGNSFYIDPLTSSKFCKDSARSLAAFYNNGALPCDCHGVGAVSP
TCDPEGGQCQCRPNVIGRQCTRCQTGYYGFPFCKLCHCGQRLCDEMTGKCICPPRTVKPQ
CEVCEKQSFSYHPLVGCKGCNCSRIGAISAPAPECDRNSGQCRCKPRITGRQCDRCASGF
YHFPECLPCNCNQDGTESGVCDPWTGACLCKENVEGAECNVCRKGSFYLDPTNPKGCTSC
FCFGISDHCHSTNKRRAKFVDMMGWRLETTDQMDIPVTFNPGSNSVVADVQELPSSVHSV
FWIAPSSYLGDKVSSYGGFLTYQVKSFGLPSEGMMLLEKRPDVQLSGQQMTIVYMDPNNP
LPDRRYYGRVQLVEGNFRHVSSNNQVSRGELMMVLSRLDGLHIRGLYFTETQRLTLGEVG
LEEVTSTGSGSIAYNVEICSCPPDYTGDSCQGCSPGYYRDNKGFYTGRCVPCNCNGHSNR
CQDGSGICINCQHNTAGANCERCKEGYYGDALQGSCQVCPCPHTNSFATGCVVNGGNVKC
SCKPGYVGVQCERCAPGYFGNPQKFGGSCQPCNCNNNGQLINCDPLTGDCINQEPKDGGP
EECDDCDSCVMTLLKDLEKMNDELRLVKSQLQSTTASAATLEQMKRLETQTKDLRNHLLN
YQSAISSHGSKVDALEKNLNSLNQDFETLHEKVQINSRKAQTLYNTVAQTNQNAKQLDTR
IQNVIRDVHVLLKQISGTDGDGNTLPSGDFSRKLAEANRMMREMRNRDFREQLRKAEAEK
IEAQVLLNRIQSTLKIHQAENNDLVKSVRDSLNEYEAKINDLRKALQEATLQTKLANGLN
QANDRSLEDVKRRIKEMSSLQSEFNKYLTTAESSLSQTNSVLQLMKKSQEDYEKLASSLN
EVRQELSDKVKDLSRSSSKESLVVEAENHAQSLQKLAKQLEEIKRNTSGDELVRCAVDAA
TAYENIINAVKAAEDAANKAVSASDSALQTVVKGDLPGKAKILSSNSDKLLREAKTTQTK
LQQDIRPALDSLRDTLDIVTTKKGLIQTDLTTVQDDLRGINRDDIDSITSNAKSLIRNAN
DITSGVLDGLNPIHTDVERIKDTYGSTRSEDFNEALSDANNSVKKLTSKIPDLLSKIQSI
NQQLLPLGNISDNVDRIRELIQQARDAANKVAIPMRFNGKSGVEVRLPNDLEDLKGYTSL
SLFLQRPDSREYGGDEEDMFVMYLGNKDASKDYIGMAVRDGKLVCVYNLGDQEAEIQMDS
ILTKSITQEAIMDRVKLQRIFQFAKLTYFKEATSHKPKPPDFYDMDSGSGDILLNLDPEN
VVFYVGGYPSNFKLPRELNYPPYKGCIELDDLNENVLSLYNFKKTFNLNTTEVEPCRRKK
EESDKNYFEGTGYARVPTQSNTPFPTFLQTIQTTVDEGLLFFAEHQDFFISLSMEKGYPV
LRYKLNSELPKEKRSRILINDGADQMITIRMGKMQNILRVTVNQTLIEVPGKIFNFNTYY
LGGIPISLRDKFNISTPAFRGCMKNLKKTIGVVRLNDTVGVTKKCSEDWKLVRTASFSRE
GQISFINVGLPDPNNFQSSFGFQTFQPHGILLRHQIGTYTLQISLENGHIELSSRDYTIL
KSPQTYMDGLLHYVSIIKDHTGLRLLIDDKTLRDNQRLPTFPDSEQSLRFGGSDFEGCIT
NAFFQRLAQSPEVLNLVSHTRREKETVSLGACNLNKPPFLMLLKNSAKISTPRTFNIDRL
QEDMRPAPLMKKEIQTNTQHCIESPQSQVSKGAYRFGDSPTSHLIYTFPKHMLKDSYRSQ
FAVDIQTTSPASGLVFFIGNKSSWMLLYISKGRIVFLLRTEGKKLRLKTKEKFNDGKWHT
VVFGHEGRKARLVIDGLKVQEGSLNGNSIFPFKPSLIFLGASPRVKLKSLPQNSFVGCLR
NFKLHGKALDTPSQNSGVRPCLGGPLEKGVYFSQDGGHISFDDSWMQGKEFKIVFGIRPR
SLTGILMHFGGQDGKYLSVYMEEGKVTATVDSGDGKMLTSVTPNQSLCDGQWHSVAVTLK
ENLLQLDLDTDSSYEAGQLPILPASNQQPLYLGGIPANLTTLTLPVQKTFFGCLKKITIN
NAVVSVTKALEVWGAVSLNGCPVH
NT seq 10335 nt   +upstreamnt  +downstreamnt
atggccggggtacagaaagggaccccaacagctgctcctactcctcggcggttcccgagg
cttttcctcctcttgctgttccccctttctggagccgctgcttctccggagccgcagacc
ggcttcagtctccatccgccttatttcaacctggcggaagcggcgaggatctcggccact
gccacctgcggagaagaccccgggagcgcgaggccccggccagagctctactgcaagctg
gtggggggccctatcgcctccaccacgggccacactattcagggccaattttgtgactac
tgtaactctggggaccccaataaagctcacccagtaaccaatgcaattgatgggactgaa
cgttggtggcaaagccctcctttgtctttgggcttacagtacaacaaagtcaatgttact
ctagatctgggacagcttttccatgtggcctacgtgcttatcaaatttgcaaattctcct
cgtcctgatctatgggtcctggaaagatctgtggactctggaagaacttacttgccttgg
caattttttgctcattctaaaatagactgttgggaacagtttgggacagatgccaacatg
cccatcactaaagacaatgatgttatctgtaccactgaatattctcggattgtgcccctg
gaaaatggagaggttgtggtatctttagtgaatggtcgtccaggagcaaaaaattttacg
ttttctcctactctgagagagtttacaaaggcaaccaacatccgcttgcgttttctccgg
accaatacccttcttggacacctgatctctaaagcccagcgagacccaacagtcactaga
aggtattattacagtataaaggatatcagcattggtggaagatgtgtctgcaatggccat
gcagaagtgtgcagagccaaaggtcctgaaaacctgtttcaatgtgaatgccaacataat
acatgtggggagagctgcgatcactgttgtgctggttacaaccagaagcagtggaggcca
gcaacagctgagagaactaatgagtgtgaagtttgcaattgccatggtcatgccacagac
tgttattatgatcctgatgttgagaggcaaagtgaaagtttgaacatccatggtgtttat
gaaggcggaggggtctgcattaattgtcagcataacacagctggtgtaaactgtgaaaag
tgcattcaaggttattaccgtccttataatgttccagtagaagcaccccatggctgtatg
ccctgcagctgtaaccctgagaacacaaatggctgtgaagagggcacaggtcgctgcttt
tgcaaatcgaatttccaaggggaaaactgtgagcgctgtgcagaaggattctacaacttc
ccattttgccagcgaattcctatttatcctatttctactccaagaccagaagcttctact
actgctgcagaaataaaagatggttgtccaccagggttctttggacctcagtgccaagct
tgtcagtgttatagcataggagcattacctggtgactgtgataggaagactggacagtgc
ttctgtcaacctggatttcatggtttctcctgtgaggagtgtgcagttggatttttccac
tatcccttctgtcagagatgtgaatgtaatccagttggcgtagtctctgaaatatgtgat
ttccaggggaagtgcctttgccgctttggagttgatggccctaagtgtgacagttgtagt
tcaggtttctactcttttcctgcttgtcaggagtgtaactgtgacccgcttggctcccag
gatggtgcttgtggacccagagggcagtgtcggtgctaccctaattatgctggcctgagc
tgcacccagtgtgctcctgattattacaactaccccagttgcttttcttgtcagtgttca
ccccttggttcataccagactacatgtgatccagttactggtcagtgtgaatgccggccg
gggattacaggacagcaatgtgatcagtgcctttcaggagcctatgattttcctcactgc
caaggtttcagtagtgaatgtaaccctgctggcactatagattccagttctggatattgc
cagtgccagctttatgtcaaaggtcctacctgcagcatctgcaagccattatactggaat
ctagcagatgaaaaccctgatggatgttcagaatgccagtgtgatgtgactggaacgcta
agtggagttggagaatgtgagcagaaagagggagaatgttactgtaaacctcatgtttgc
ggtgattcctgtaatacatgtgaagatggctattttgctctaggagacagcaattacttt
gggtgtcaagggtgccactgtgacattgggggatctgtcagctttatgtgcgatgacctt
tctggagcatgtcaatgtagggaacatatcatgggccagtcatgtcaacagccagaagac
aattattatttccctgatttacatcacattaaatttgaaattgaagatggcatgacacct
aatggaagaggtgttcgatttggctttaatcctttggagtttcctgatttcagttggcga
ggctatgcgcagatgaccccagtacagaacgaagtgagggtaacactgaatgtggagaaa
tcaaaccaatatttatttcgtgctgttctgagatatattaaccctggaactgaaacagtg
tttgggcacataaatatttatcggccccattctaaggcaggtgctattcaaagcaaagag
attgtcttcctgcctagcaaagagccagcttttgtcactgtcccaggaaatggttttgca
gatccattttccctcactccaggaacatggactgttagtataaaggctgagggcatcctt
ctggattacctggtgctcctacccagtgactattacgaagcttcaatcttgcaattacca
gtcacagagccctgtgcctactcaggacctatcgaagagaattgcctgctttatcagcat
ttgccagtgaccagatttgcctgtgccttggcttgtgaagcagaacgcttcctgcttaat
ggaatgccgcaagtgttggcaactcggaaacccacccctgaacttcccatcatggctgac
atcagtgggagagagattgaattgcatctgactctgagcattcctcaagttgaccactac
gtgatagttcttgaatataccaatgaagatgatcagctctatgttgctgatgtgcttgtc
aacaccccaagtccttcaccagcaggtcgagtgaacatatatagctgtaaatacagcttt
ctctgtcggagttttgtggtggatgatctgaaccgtgttgctgtgtatgaactcttagca
gatgcaaggatccagttgaaggcacactttgcccattttcttctgcaccaaatttgtatt
ataccagtgggagaattctctacagaatatgtgaaacccagcatacactgcatcgccagt
tatgggcaatttgttaatcaaagttcctcctgtgtccttttagcacatgaaactcctcca
agagcattagttttggatgcactaagtggtggaatgagtcccgttgtgcccccggatcct
tcacctttagaatctgtgttccagggcatcgtcctgaagtcgccacagaatcaagttacc
ttgaatggaagagtgccacatctgggtcaatatgtcttcattgtccatttttgtcagcca
gatcatccctcatttcctgcacaggtggttgtagagggagggcatctgtggtcaggttct
ttcagtgcctatttctgtcctcaagtatttggctgccggaacttagtaattgcagagagc
cagactaacctggacctcagtgaaccagagttctcagtgactataaaggttccggatgga
aaatccttgatgctgggccatgtcctagttgttccagcagagaactatggctaccacatg
cttcacaagaaaacagtggacaaatcatttgattttatcaataattgtggaggaaacagt
ttttatattgaccctctgacatcatcgaaattctgtaaggattctgcccgctccctggct
gccttctataacaatggagccttaccttgtgattgtcacggggtgggagctgtcagccct
acctgtgacccagaggggggacagtgccagtgccgacccaatgtcattggtcgtcagtgt
acccgatgtcaaactggctactatggttttccattctgcaaattgtgccactgtggtcag
cgcctttgtgatgagatgactggaaaatgcatctgcccccctcgcacagtcaagcctcaa
tgtgaagtatgtgagaagcagtccttcagttaccacccattggttgggtgcaaaggctgc
aattgctccaggatcggggctataagtgccccagccccagagtgtgacagaaacagtgga
cagtgcagatgcaagcccagaataacaggacgtcagtgtgatcgctgtgcatctgggttt
tatcatttccctgaatgtcttccttgcaattgcaaccaagatgggactgagtcaggagtc
tgtgatccatggacaggtgcatgcctttgtaaggaaaatgtagaaggtgcagaatgtaat
gtttgccggaaagggtcattttacttggaccccactaatccaaagggatgtaccagctgc
ttctgttttggaataagtgatcactgccacagtacaaataagcggagggctaagtttgtt
gacatgatgggttggcgcctggagacaacagatcaaatggacatccctgtcaccttcaac
ccgggcagtaacagtgtggttgctgatgttcaggaactgccttcctcggtccatagcgtg
ttctggattgcaccatcatcctatctgggggacaaggtttcttcctatggtggcttcctg
acttaccaggtaaaatcctttggcctacccagtgaaggcatgatgctcttggagaagaga
cctgatgttcagctttcgggacagcaaatgactattgtctacatggacccgaacaaccct
ctgccagaccgacggtattatggacgagttcagttagttgagggaaacttcaggcatgtc
agcagcaataaccaggtatctagaggagagctgatgatggttctgtctagactggatggc
ttacacatcagaggcctttattttactgagactcagcggttaaccctaggtgaggtgggt
ctggaagaagtcaccagtacaggaagtggaagcatcgcatacaatgtagagatatgttcc
tgcccccctgactatactggtgactcatgccagggttgtagtcctggatattatcgggac
aacaagggtttctatacaggacgatgtgttccctgcaattgtaatggacattcaaatcgc
tgccaggatggctccgggatctgtattaattgtcaacataacactgctggtgcaaactgt
gagagatgtaaagaaggttactatggagacgccctccaaggttcctgtcaggtctgccca
tgccctcatacaaacagttttgctactggctgtgtcgtgaatgggggaaatgtgaaatgt
tcctgcaaacctggctacgtgggagtccagtgtgaaagatgtgcaccaggatattttggg
aatccccagaaatttggaggtagttgccaaccatgcaattgcaataataatggccaatta
atcaactgtgatccactgactggagattgtattaatcaagaacccaaagatggaggccct
gaagaatgtgatgactgtgacagctgtgtgatgactctcctgaaggacctggaaaagatg
aacgatgagcttcgactggtcaaatcacagctccagagtactactgcaagtgccgccact
ctggagcaaatgaagcgcttggaaacccagaccaaagacctgaggaatcatttgctcaac
taccagtctgctatttcaagtcatggatcaaaagtagatgccctggaaaaaaaccttaac
agtctgaatcaggattttgaaaccttacatgaaaaggttcaaataaattcaaggaaagcc
cagacattatataacactgttgctcagacaaatcaaaatgcaaaacagctggatactagg
atacaaaatgtcatcagagatgttcatgttctcctgaaacagatctctgggacagatggt
gatggaaacaccttaccctcgggtgacttttccagaaaactggctgaagctaaccgtatg
atgagggaaatgagaaatcgcgacttcagagagcaactgagaaaagcagaagctgaaaaa
attgaggcacaagtcttgctaaatcgtattcagagtaccctgaaaatccaccaggcagag
aacaatgatcttgtgaaaagtgttcgagattctctaaatgaatatgaagccaagatcaat
gacctccgcaaagctctgcaagaagcaacccttcaaacaaagctagccaatggtctcaac
caagctaatgatcgatccctggaagacgttaagagacgaattaaggaaatgagctcccta
caaagtgaattcaataagtacctcaccactgctgaatcatctttgtcacagaccaacagt
gttctccaactgatgaagaaaagccaagaggactatgagaagttagcatccagtttaaat
gaagtaagacaagaactgagtgacaaagtgaaggatctttctcgatcatctagcaaagaa
tccctggtggtagaagcagagaatcatgcccaatctctacagaagttagcaaagcaattg
gaagaaatcaagaggaataccagtggtgatgaattagtgcgctgtgctgtggatgctgct
acagcctatgaaaacatcatcaatgcagtgaaagcagccgaggatgcagccaataaggca
gtgagcgcatcggactctgccctacagactgtggtgaagggagatctgcctggaaaagcc
aagattttgagctccaacagcgataagttactaagggaagcaaagaccacacaaactaaa
ttacagcaagacatcagaccagctctggacagcctgcgggacaccttggatattgttaca
acaaagaaaggcttgatacagacagacctcactactgtccaagatgatctccgtgggata
aatcgagatgatattgatagtataaccagcaatgccaagagtttaatcagaaatgcaaat
gacatcacaagtggtgtgctggatggtctcaacccaattcacacagatgtggaaagaatt
aaggacacctatggaagcacacggagtgaagactttaatgaggccctgagtgatgcaaac
aattcagtgaaaaaattaaccagcaagataccagatctcttaagcaagattcagagtatc
aaccagcaactcttaccactgggcaacatctctgacaatgtggaccgaataagagaactc
attcagcaggctagagatgctgcaaataaggttgctattccaatgagattcaatggcaag
tctggtgttgaggttcgactgccaaatgaccttgaagatttgaaagggtacacatctctc
tctttgtttcttcaaagacctgactccagagaatatggtggggatgaagaagacatgttt
gtgatgtacttgggtaataaagatgcatcaaaggactatataggtatggcagtaagagat
ggcaaacttgtatgtgtctataacttgggagaccaggaagctgagatccagatggactct
attttgactaagagtataactcaagaagcaattatggatcgagtaaaattgcaaaggatc
ttccagtttgcaaaactcacctactttaaagaagccacatcccataagccaaaacctcct
gatttctatgacatggatagtgggagcggcgacattcttctcaatttggatcctgaaaat
gttgtcttttatgttggaggctatccatctaatttcaagcttcctcgtgaactaaattat
cctccctataagggctgcattgaattagatgacctcaatgaaaatgttctaagcctatac
aacttcaaaaagactttcaatctcaatacaacagaagtggagccttgtagaaggaaaaaa
gaagagtccgacaaaaattattttgaaggcacaggttacgcacgggttccaacccaatcc
aacactccttttccaacctttctacagacaattcagaccaccgtagatgaaggtttattg
ttctttgcagaacaccaagatttctttatatctttaagtatggaaaagggatatcctgtg
ttgcgatataaattaaattcagagcttccaaaggaaaaaagaagtcggatactcataaat
gatggagcagatcagatgattacaatcaggatggggaaaatgcaaaacattctacgagta
actgtgaatcaaacactcattgaagttccgggtaaaattttcaatttcaacacatattat
cttggaggaattccaatctcactccgagacaagtttaacatatccactcctgccttccga
ggctgcatgaaaaatctaaagaaaaccattggtgttgttaggttgaatgatactgtagga
gtcaccaaaaagtgctcagaagactggaagcttgtaagaacagcatcattttccagagaa
ggacagataagtttcattaacgtggggctgccagatcccaacaacttccagtcttctttt
ggatttcagacctttcaaccccatggcatattattaagacaccaaatagggacatatacc
ctacaaatctctctggaaaatggtcacatagaattaagctctagagattatactattttg
aaatctccccagacgtatatggatggtttactacattatgtatctataataaaagatcat
actggactaagacttctgattgatgacaagaccctaagagataaccaaagattaccgaca
ttcccagactcagagcaatccctacgctttggtgggagtgactttgaaggatgtatcact
aatgcatttttccagagattagcccagagtcctgaagttctcaatttagtcagtcatact
cggagggaaaaggagacggtgtccctaggggcctgcaatttaaacaagccaccttttcta
atgctgctgaaaaattcagcaaagatcagcacaccaaggacattcaacattgataggcta
caagaagatatgcgtcctgcccctctgatgaagaaagagattcagacaaacacccagcac
tgcattgaatcacctcagtctcaggtttctaaaggagcttatcggtttggggacagtccc
actagccacttgatctacacattccctaagcatatgctgaaagacagttacagatcacag
tttgctgtggacatacagacaacttcccctgcttcaggacttgtgttttttatcgggaac
aagagctcttggatgttgctttacatttcaaaaggacgcattgtctttttgctgaggaca
gaaggaaagaaactaagactgaaaaccaaagagaaattcaatgatgggaagtggcacacg
gttgtgtttgggcatgagggaaggaaagcccgtcttgtcatagatggtctaaaagtccag
gaaggaagcttgaatggaaattctatctttcctttcaaaccatcactgatcttcctgggg
gcctctcccagggtgaaactgaagagcctcccccaaaacagctttgtgggatgcctgagg
aactttaagttgcatggaaaggccttagatactccctctcaaaactctggggtaagaccc
tgtttgggtggccctcttgagaaaggagtatatttctctcaagacggtgggcacatcagc
tttgatgactcctggatgcagggaaaggaatttaaaatagtctttggaattcgtccaaga
agcctcactggaattttaatgcattttggaggacaagatgggaagtatttaagtgtttat
atggaagaaggaaaggtcactgctactgtggacagtggggatggtaagatgctgacatca
gtcacacccaaccaatctctgtgtgatggacagtggcattctgtggcagtcactctaaag
gagaatttgctgcagctcgacctggacacagatagcagctatgaagctggacagctgccc
atcctgccagccagcaaccagcagcctttgtatttgggaggcattccagctaacttgaca
acattgacactgcctgtgcaaaaaaccttctttggctgcctcaagaagatcacaatcaac
aatgcagttgtctctgtcacaaaggccttagaggtctggggagctgtcagtctgaatggc
tgtcctgtccactaa

KEGG   Sarcophilus harrisii (Tasmanian devil): 100935179
Entry
100935179         CDS       T02286                                 

Gene name
LAMC3
Definition
(RefSeq) laminin subunit gamma-3 isoform X1
  KO
K06247  laminin, gamma 3
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr04151  PI3K-Akt signaling pathway
shr04510  Focal adhesion
shr04512  ECM-receptor interaction
shr05145  Toxoplasmosis
shr05146  Amoebiasis
shr05165  Human papillomavirus infection
shr05200  Pathways in cancer
shr05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:shr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100935179 (LAMC3)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100935179 (LAMC3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100935179 (LAMC3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100935179 (LAMC3)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100935179 (LAMC3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100935179 (LAMC3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100935179 (LAMC3)
   05145 Toxoplasmosis
    100935179 (LAMC3)
SSDB
Motif
Pfam: Laminin_EGF Laminin_N Laminin_B
Other DBs
NCBI-GeneID: 100935179
NCBI-ProteinID: XP_023350062
Ensembl: ENSSHAG00000016927
LinkDB
Position
2
AA seq 1578 aa
MEEFLGLSLGILLCLALAQGGMDACYDERGRPQRCLPVFENAAFGRQAQVTNTCGSPPEE
YCLQMGAPGDTQLCHRCDARHPDHSHNASYLTDFHSQEESTWWQSQSMAFGVQYPNSVNI
TLQLGKAYEITYVRLKFHTSRPESFAIYKRSWAGGPWVPYQYYSASCEKTYGKREDQYLR
PGEDERVAFCTDEFSDISPLSGGNVAFSTLEGRPSAYSFDESPILQEWVTSTDLLISLNR
LNTFGDDIFKDPKVLQSYYYAITDFSVGGRCKCNGHASECVLDEGGQLVCSCQHNTTGTD
CERCLPFYQDRPWARGTAEAANECLPCNCSGLSEECFYDWELYRSTGRGGHCRNCRDHTA
GPHCEYCQENFYRWDQQQPCQPCDCHPAGSLSLQCDNSGTCECKPSVTGWKCDRCLTGFH
SLSEGGCRACACNGAGSLGPCDSRNGRCPCKDKVEGYLCDRCQPGTFNLQPHNPSGCTSC
FCYGHSMVCAASTHYGIRYIISEFHQGAEGWQIRGPGGREKPAQWSQRGIFLEPKGEELW
DFVAPEKFLGDQRFSYGQSLSLTFWVPPGGSLLPVRLKLEGAGLTLFLKPSSPTASQQPG
RPEEYLLVFSLQETSEDTNLPLPAFHFQRLLANLTGLQIEITGPGGRHSTGQMILTEVQL
TSAGPGLSPLAPWVEECTCPEGYMGQFCESCSLGYKRETPLGGPYASCVPCTCNQHGTCD
PETGICQCLHHTEGPYCERCTSGFYGNPFLGHVDDCKPCPCPGQSACTTIPESGEVVCTH
CPKGQRGRLCEICDDGFFGDPLGRSGPRQPCQRCQCNGNVDPNAVGNCNPTTGHCLRCLY
NTTGAHCEQCQEGFYGSALAPHPLDKCTPCSCNSSGSTREQGACDPRTGQCSCLPHVTGR
DCSHCSPGFYDLQPERGCRSCKCHPVGSQENQCHPVTGQCPCLPGVSGVACTHCQPDFFG
FSAKGCRACNCSPLGSVTTQCHENSTCVCKPGFVGYKCDHCKENFFLTAEGSQCQECPIC
FSLVKKEATKLKATLTMMEQWLRKSDCDSPWSNYILLGESTRGDAYQGSYLLQGTREAFL
EQMEELESSMRAARHQLRAASESVNCAKNSLEKTCIQLEDIEALLLSTEQEVQQASGALR
TMVIPQEVPHQLTNWSHLASESQALAKSHRDIATKIEAAAQRALLASNTSYTLLWSLVEG
TDAQKIQRELEDKYQEVQRAQEELRTSTAQAVKEAKSVLTSVQHVSSERARHLAKLSTPE
ILPLTHLARDLDRKLQDLEKTVASREQVFTRAAQDLLATSQGEFQKIQPFQQLHDGADAA
LSLATSSIAKTRVTVRDSKTLLTDLEEMRKTFPQPKDQASLRRKARIIQDKLIGDTQKKT
KQAERMLGNAASVSATAKKKAKEAELLAKESTKHSKALLRESKQQYRQAVKLANQAQGAL
RDISRQVMVSKDRRKEMEKIEWVGTGLNKVERSIREARISLEMDIKTLSILLTRLGKLDP
YQALASALNETEQKLEPLRQRLDGQGPLQDKLSLLEQEAEQQELQIQDLESDLKEIQADK
QNLEDILHSLPEGCASWQ
NT seq 4737 nt   +upstreamnt  +downstreamnt
atggaggagttcctcgggctctctctggggatcttgctctgcctggctctggcccagggg
ggcatggatgcttgctatgatgagcgagggcgccctcagcgttgtctgcctgtgtttgag
aatgcagcctttggccgccaggcccaggtgaccaacacctgtggctcgccacccgaggag
tactgcctccagatgggcgcccctggagacacccagctgtgccatcgctgtgacgcccgc
cacccggaccacagccacaatgcctcctacctgacggacttccacagccaggaggagagc
acctggtggcagagccagtccatggccttcggggtccagtaccccaactcggtcaatatc
accctgcagctgggaaaagcttatgagatcacctacgtgaggctgaagttccacaccagc
cgtcctgagagttttgccatctacaaacgcagctgggctgggggtccctgggtgccatat
cagtattatagtgcttcctgtgagaagacgtacggcaagcgggaggaccagtacctccgg
cccggggaggatgagagggtggccttctgcactgatgagttcagcgacatctctccactg
agtggaggcaacgtagccttttccaccctggaaggccggcccagtgcctacagctttgat
gagagtcccatcctgcaggaatgggtaaccagcacagacctactcatctccctgaaccgg
ctcaacacatttggggatgacatctttaaggaccctaaagtgttacagtcctactattac
gccatcactgacttttctgtggggggcaggtgcaagtgtaacgggcatgctagcgaatgt
gtacttgatgaaggaggccagctagtctgcagctgccagcacaacactacaggaacggac
tgtgagagatgcctccccttctaccaagaccgaccctgggcacggggcacagcggaggct
gccaatgagtgtctgccctgcaattgcagtggcctctctgaagaatgtttttatgattgg
gagctgtatcggagcactggtcgtggggggcactgccggaactgtcgggaccacactgct
ggaccccattgtgaatattgccaagagaacttctatcgctgggatcagcagcagccatgt
cagccctgtgattgccacccagctggatctcttagcttacagtgtgacaactcaggcacc
tgtgagtgtaaacccagtgtaactggttggaagtgtgatcgctgcctgacagggttccat
tctcttagtgaaggtggatgcagagcctgtgcctgcaatggtgccggcagcttaggacct
tgtgattccagaaacggaagatgcccttgcaaggacaaggtggaaggctacttatgtgat
agatgccaacctgggacatttaacctgcagccccataatccttctggttgcaccagctgc
ttctgttatggccactccatggtgtgtgcagcttccacccattatggtatacgctatatc
atctctgagttccaccagggagctgaaggctggcaaatcagaggtccagggggcagagag
aagcctgcacagtggagccagcgtggaattttcctggagccaaagggagaggagctatgg
gactttgttgcaccagagaaattcctgggagaccagcgcttcagctatgggcagtccctc
tctctgaccttctgggtcccacctgggggctctctcctccctgtccggctgaagttggaa
ggggcaggactaaccctgtttctgaaaccctccagcccaacagcctcccaacaacctggc
cggcctgaggaatacctgctggtattcagcttgcaggagacctcagaagacacaaatctc
ccgctccctgcctttcacttccagaggctcttggccaacctgacaggactccagattgaa
atcacaggtcctggaggcaggcattccacaggtcaaatgatcctgactgaggtccagctc
acgtcagcaggccctggtctgtccccgctagccccctgggtagaggagtgtacatgtccc
gagggatacatggggcagttctgtgaatcctgctctctggggtacaagagggagacacca
ttgggcgggccttatgccagctgtgtcccctgcacctgtaatcaacatggcacctgtgat
cctgaaacagggatttgtcagtgcctgcaccatacagaaggcccttactgtgagcgatgc
acatctggtttctatggcaacccctttttgggtcatgtggatgactgcaagccctgtcct
tgtcctggtcaatcagcttgtacaaccatcccagagagtggagaggtggtgtgtacccat
tgccctaagggtcagagaggacgtctgtgtgagatatgtgatgatggctttttcggggac
cccttgggaagatctggccctcgccaaccctgccagcgatgccagtgcaatgggaatgtg
gaccccaatgctgtgggcaactgtaaccccacaacaggccactgcctgcgctgcttatac
aacacaacaggtgcccactgtgagcagtgccaagagggtttctatgggagtgctctggcc
ccacaccctctagacaaatgcaccccctgcagctgtaactcatcaggctcaaccagagag
cagggggcttgcgaccccaggacaggccagtgttcatgcctcccccacgtgaccggacga
gactgcagtcactgtagccctggtttctatgatctccagccagagaggggctgcaggagc
tgcaagtgccatcctgtaggctctcaggagaaccagtgccaccctgtgactgggcagtgc
ccttgccttcccggggtcagtggagtggcatgtacccactgccaacctgatttctttggc
ttctctgccaagggctgccgagcctgtaactgctccccactgggctctgtcaccacccag
tgccacgagaacagcacttgtgtgtgtaagccaggcttcgtgggctacaagtgtgatcac
tgcaaggagaactttttcctcactgctgagggatctcagtgccaggagtgcccaatctgc
ttctccttagtgaagaaagaggccaccaaactcaaggccacgttaacaatgatggaacag
tggctgcgaaaatctgactgtgacagtccctggagcaattatatcttgctgggagagtca
acgagaggagatgcctaccagggaagttatttgcttcaaggcaccagagaagccttcctg
gagcaaatggaagaactggaaagttccatgagggctgcccggcatcagctgcgggcagca
agcgagagcgtcaactgtgccaaaaatagtttggagaagacctgcatccaactggaggat
atcgaggctctgctgctatcaacagagcaggaggttcagcaggcatctggagccctcagg
acgatggtaatccctcaagaagtaccccaccagctcaccaattggagtcatctagcctct
gagtctcaggctctggccaagagtcatagagacatagccactaagatagaggcagctgca
caaagggctctgctggcttccaataccagttatactcttctatggagtcttgtggaggga
acggatgcccagaagatccagcgtgagctagaggacaaataccaggaggtgcagagggcc
caggaggagctcagaacatccacagcccaggcagtcaaagaagccaagagcgtattaaca
tctgttcagcatgtcagctccgagagggctcggcacctagcaaagctctccactcctgaa
atactgcctctcacacaccttgccagggacctggacagaaaattacaggatctagagaag
acagtggcttctagggagcaagtgttcaccagagcagcccaggatctcttggctacttcc
cagggagagttccagaagatccagccctttcagcagctccatgatggggctgatgctgcc
ctcagcctggccacctcatccattgccaaaaccagagtcacagtcagggattccaagact
ttgctgaccgatctggaagaaatgagaaaaacatttccacagcccaaggaccaggcttct
ctaaggagaaaggcgaggatcatccaagacaaactcattggtgacacccagaagaagact
aagcaggcagaaagaatgctaggaaatgctgcttctgtctccgccacagctaagaagaag
gccaaggaagctgaactactggctaaagagagtacaaagcattccaaagccttgctgagg
gaaagtaaacagcaataccgacaagcagtcaaacttgccaaccaagcacaaggagccctg
cgagacatctccaggcaggtgatggtgtccaaggaccgaaggaaggagatggagaaaatt
gaatgggtagggactgggttgaacaaggtggaaagaagcataagggaagctcggatctcc
ctggagatggacatcaagaccttgtctattctgcttaccagactgggaaagctggaccct
taccaagctctagcttcagccctgaatgagactgagcagaagctggagccactgaggcag
cgcctggacgggcaggggcccctgcaggataaactgagcctgctggagcaggaggcagag
cagcaggagctccagatccaagacttggagagtgacctcaaggaaatccaggcagacaag
cagaacctggaggacattctgcacagcctgcctgagggctgtgccagctggcagtga

KEGG   Sarcophilus harrisii (Tasmanian devil): 111719421
Entry
111719421         CDS       T02286                                 

Definition
(RefSeq) laminin subunit beta-2-like
  KO
K06243  laminin, beta 2
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr04151  PI3K-Akt signaling pathway
shr04510  Focal adhesion
shr04512  ECM-receptor interaction
shr05145  Toxoplasmosis
shr05146  Amoebiasis
shr05165  Human papillomavirus infection
shr05200  Pathways in cancer
shr05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:shr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    111719421
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    111719421
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111719421
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111719421
  09162 Cancer: specific types
   05222 Small cell lung cancer
    111719421
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    111719421
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    111719421
   05145 Toxoplasmosis
    111719421
SSDB
Motif
Pfam: Laminin_EGF Laminin_N F5_F8_type_C
Other DBs
NCBI-GeneID: 111719421
NCBI-ProteinID: XP_031815216
LinkDB
Position
1
AA seq 1348 aa
MPSQGVGSLSLRYWITTAPHLSATNQVGHGFIVLLLLIQIPSACAHEIPDLLPPPGCSGG
SCYPPTGNLVVGRSQSLHASSTCGLRGPEPYCIVSHLQDSEKCFFCDSRGQGGHRIKNVI
SLSGPDGERTWWQAESGVENVSIQLDLEGEFYFTHLIMTFKTFRPAGLLIERSADGGRSW
RVYRYFAHNCSGLFPGIPLTPGRKVSDLVCDQRYSNIEPSSQGEVIFKVLDPAIPVEDPY
SPEIQELLRVTNLRVNFSKLHTLGDGPLGGWGHRHGPHYYYALYELVVRGSCLCHGHASE
CAPAPGAPPSVEGMVHGLCVCQHQTAGPHCERCQDLFHDQPWRPAEPGNAHACRECECHQ
HARSCHFDMAVFVASGNVSGGVCDACQHHTAGRHCEICRPFYHRDPREDPRSPYTCKPCD
CDPSGTLDGGLCDTHTDEVRGLLSGQCRCKAHVWGPRCDTCRPGYYGLSPALPEGCLSCR
CDPRGTVPGDTPCDSISGDCYCKRFVTGQNCDQCLPEFWGLSSDFTGCRPCDCDFGGAYS
NRCSSGEGLCPCRPHLQGRDCLELQSGYFCAALDQAVAEAELGQRLRPSDARLPGAPLPD
APPDCLPTTGPVLKRLRARLRRHRSTPCPPRSTRHGRQSHQAFKAVVEPRPWGRGPPGSS
WTGPGFARVEDRAGLMLQAPPVPRAMEYDIVLRYEAQAPEDWEALVSVRAYSLPSSTRCA
NVLPSEQLYQVALPPRHRAVVLSRPFCFEPGTRYMVTLRLQRMTSARNLPGGTILLDSLV
LLPRVEELPGLRRGDPGALGRLRELSRAQCLEAARTPYLGPPSESCARLVCSISALLYSG
GLACECDPQGSLSSECARVGGQCPCRPHVIGQRCDQCKPQTYGFGPAGCSECRCSPEGST
SLTCDSLSGQCSCQPGITGRRCDRCLPGQWGFPHCQPCECNGHTEQCHPHTGACQACGDA
TTGRHCERCQDGYYGDPVLGSGQQCRPCPCPGFLGSGNYHATSCQADGGSERILCFCAPG
YAGPRCDRCSAGYFGRPWPEGIVGGAPCRPCQCNNNIDPSDPMACDPHSGHCQRCLHHTH
GPHCSHCQPGYYGNALRPRGCRRCGCDQRGTVPGRCPPGSGICFCDRLSGHCPCRPHVLG
RLCDRCAPQFWNLGGPRGCEPCACHPQHSVQPACHLVTGQCPCREGFGGRTCSQCQEGYW
GDPEKECRACACDPQGSISLRCHPRTGACSCLEGISGPRCKACARGSQGSFPHCRPCPTC
FSHWDGRLDALQQRLVTLAQGRDALREVATDWGSGGRLLALETAIGQVQGILVSAHPLVG
PSQQLMQQRDGLRQDQAPQRLGEGWAGS
NT seq 4047 nt   +upstreamnt  +downstreamnt
atgcccagccagggagtgggtagcctgagccttcggtactggataaccactgctccccat
ctctcagccacaaaccaagtgggccacggcttcattgtgctgctgctgctaatacagata
ccctctgcctgtgcccatgaaatacctgatcttctgcccccacctggctgctctggaggg
agctgttatcctcccactggcaatctagttgtgggcaggagccagagtctccatgcctca
tccacctgtggtttaaggggacctgaaccctactgcattgtcagccacttgcaggactct
gagaaatgcttcttctgtgactcaagaggtcaaggaggccatagaatcaagaatgtgatc
tccctcagtggacctgatggggaaagaacatggtggcaagctgagagtggcgtggagaat
gtcagtatccagctggacttggagggcgaattctacttcacccaccttatcatgactttc
aagacttttcgacctgctggtctactcattgagcgttcagcggatgggggtcgttcctgg
cgagtttatcgatactttgctcacaactgctctggcctcttccctgggattccacttaca
ccaggccgaaaagtcagtgatctcgtttgtgatcagcgttactcaaacattgaaccatca
agccagggtgaggtaatttttaaagttttggacccagccatccctgtggaggatccctat
agtccagagatccaagagctgcttcgagttactaatctgagggtgaatttctctaaacta
cacacgttgggagatgggcccctagggggctggggccaccgtcacggtcctcactactac
tatgctttgtatgagcttgtggtccgaggaagttgcctctgccatggacatgcctctgag
tgtgcacctgcccctggtgccccacccagtgtggagggcatggtccatgggctttgtgtt
tgtcagcaccagacagctggaccccactgtgagcgctgccaggacctgttccatgaccag
ccctggcgcccagccgagcctgggaatgctcacgcctgccgggagtgtgaatgccaccag
catgccaggagttgccactttgacatggctgtttttgtggcctcgggcaacgtgagtgga
ggtgtgtgtgacgcatgtcagcaccacacagctggaaggcattgtgagatctgccgacca
ttctaccatcgggacccccgtgaagacccccgctccccatacacctgtaaaccttgtgac
tgtgatccgtcaggcaccctggatgggggtctgtgtgacacacacacagatgaggtccga
gggctcctctctggacagtgtcgctgtaaagcccacgtgtgggggcctcgctgtgacacc
tgtcgtcctggttattatggtctgagtccagcattacctgaaggttgtttgtcctgcagg
tgtgatcctcggggcacagtcccaggtgacactccttgtgactccatcagtggtgactgc
tattgcaaacgttttgtcactggacagaactgtgaccagtgcctgccagaattctgggga
ctgagcagcgactttactggttgccggccttgcgattgtgattttggtggcgcttacagc
aacaggtgctcatcaggggaggggctttgtccttgtcgcccccacttgcaaggccgagac
tgccttgagctccagtctggttacttctgtgcagccttggaccaggccgtagccgaggcg
gagcttgggcagaggctcagaccctccgacgcccggctgcctggagcccctctacccgat
gcccctcctgactgcctgccaacaacaggacctgtgctgaagaggcttagagcccggctc
cggcgtcatcgaagcaccccctgccctccccgcagtactcgccatggacgccagagccat
caagctttcaaggctgttgtggagccccggccttggggcagaggccctcctggctcctcc
tggactggccctggatttgccagggtggaggacagagctggcctcatgctccaggcccct
ccagtgccacgagccatggagtatgacattgtgctgcgctacgaagctcaggcccccgag
gactgggaggcccttgtcagtgtccgtgcctactccctgcccagcagcacccgttgtgcc
aatgtgttgccctcagagcagctctatcaggtggccttaccccccaggcacagagctgtg
gtcctgtctagacccttctgctttgaacctggaaccagatacatggtgaccttgagacta
cagcgaatgacaagtgcacggaacctccctgggggaaccattctgctagactcgctagta
cttctgcctcgagtagaggagcttccaggtctaagaaggggggaccctggggcattgggg
cgcctgagagaactcagtcgagctcaatgccttgaagctgcaagaacaccctaccttggg
cccccttcagaatcctgtgcccgcttggtctgtagcatctctgctctgctatatagtggt
ggcctagcctgtgagtgtgacccacaggggtctctgagctctgagtgtgcccgtgtgggg
ggccagtgtccatgtcgaccccacgtcatcggccagcgctgtgaccagtgtaaaccacag
acctacggctttggcccagcaggctgcagtgaatgtcgctgctcccctgagggctccacc
agtttgacctgcgattctttaagcggccagtgctcgtgccagccaggaatcacaggacga
aggtgcgaccggtgcctgcctggccagtggggcttccctcattgccagccctgcgaatgc
aacgggcatacagagcagtgccacccacacactggggcgtgccaggcctgcggagacgcc
accactgggcgccactgtgaaaggtgccaggatggttattatggagatcctgtcctgggc
tcaggacagcaatgccggccttgcccctgccctggcttcctgggctctggaaattaccac
gcaacctcatgtcaggcggacggtggtagtgaacggatcctgtgtttctgtgcacctggt
tatgcaggtcctcgctgtgaccgctgctctgctggctactttgggcgtccctggccagag
ggaatagttggtggggcaccgtgccgaccctgccagtgcaacaacaacattgaccctagc
gatcccatggcctgtgacccccacagtgggcactgccagcgctgtctacaccacacccat
gggccacactgttcccactgccagcctggctactatggcaatgccctccggccacgaggc
tgccggcgttgcggctgtgaccaacgaggcacagtacctggccggtgcccgcccggaagt
ggcatctgcttctgtgacaggctcagcggtcactgcccctgccgcccacatgtgctgggg
cggctttgtgaccgctgtgcccctcagttctggaacctgggcgggcctcggggctgcgag
ccttgtgcttgtcacccccagcactcggtgcagccggcctgtcacctggtaactggtcag
tgcccatgccgggaaggatttgggggacgtacgtgctcccagtgccaagaagggtactgg
ggggacccagagaaggagtgcagagcctgtgcctgtgaccctcagggttcaatctctctc
cgttgccaccctaggacaggggcttgctcgtgccttgaaggcatttcaggccctcggtgc
aaagcctgtgcccggggttcccagggcagtttcccccactgccgtccctgtccaacctgc
ttctctcactgggatggacgactggatgccctccagcagcggctggtcacattggctcag
gggagggatgccctgcgtgaggtggctactgactggggcagtggtgggcggctgctggcc
ctggagacagccatagggcaggtccagggaatcctggtgtccgcccaccccctggtgggg
ccctcgcagcagctcatgcaacagcgggatggactcaggcaagaccaggcgccccagagg
cttggagaggggtgggcaggatcttag

DBGET integrated database retrieval system