KEGG   Sarcophilus harrisii (Tasmanian devil): 100917396
Entry
100917396         CDS       T02286                                 

Gene name
MAP2K2
Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 2 isoform X1
  KO
K04369  mitogen-activated protein kinase kinase 2 [EC:2.7.12.2]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr01521  EGFR tyrosine kinase inhibitor resistance
shr01522  Endocrine resistance
shr04010  MAPK signaling pathway
shr04012  ErbB signaling pathway
shr04014  Ras signaling pathway
shr04015  Rap1 signaling pathway
shr04022  cGMP-PKG signaling pathway
shr04024  cAMP signaling pathway
shr04066  HIF-1 signaling pathway
shr04068  FoxO signaling pathway
shr04071  Sphingolipid signaling pathway
shr04072  Phospholipase D signaling pathway
shr04140  Autophagy - animal
shr04150  mTOR signaling pathway
shr04151  PI3K-Akt signaling pathway
shr04210  Apoptosis
shr04218  Cellular senescence
shr04270  Vascular smooth muscle contraction
shr04370  VEGF signaling pathway
shr04371  Apelin signaling pathway
shr04540  Gap junction
shr04550  Signaling pathways regulating pluripotency of stem cells
shr04620  Toll-like receptor signaling pathway
shr04650  Natural killer cell mediated cytotoxicity
shr04660  T cell receptor signaling pathway
shr04662  B cell receptor signaling pathway
shr04664  Fc epsilon RI signaling pathway
shr04720  Long-term potentiation
shr04722  Neurotrophin signaling pathway
shr04730  Long-term depression
shr04810  Regulation of actin cytoskeleton
shr04910  Insulin signaling pathway
shr04912  GnRH signaling pathway
shr04915  Estrogen signaling pathway
shr04916  Melanogenesis
shr04917  Prolactin signaling pathway
shr04919  Thyroid hormone signaling pathway
shr04921  Oxytocin signaling pathway
shr04926  Relaxin signaling pathway
shr04929  GnRH secretion
shr04934  Cushing syndrome
shr04935  Growth hormone synthesis, secretion and action
shr05010  Alzheimer disease
shr05022  Pathways of neurodegeneration - multiple diseases
shr05132  Salmonella infection
shr05135  Yersinia infection
shr05160  Hepatitis C
shr05161  Hepatitis B
shr05163  Human cytomegalovirus infection
shr05164  Influenza A
shr05165  Human papillomavirus infection
shr05166  Human T-cell leukemia virus 1 infection
shr05167  Kaposi sarcoma-associated herpesvirus infection
shr05170  Human immunodeficiency virus 1 infection
shr05200  Pathways in cancer
shr05205  Proteoglycans in cancer
shr05206  MicroRNAs in cancer
shr05210  Colorectal cancer
shr05211  Renal cell carcinoma
shr05213  Endometrial cancer
shr05214  Glioma
shr05215  Prostate cancer
shr05216  Thyroid cancer
shr05218  Melanoma
shr05219  Bladder cancer
shr05220  Chronic myeloid leukemia
shr05221  Acute myeloid leukemia
shr05223  Non-small cell lung cancer
shr05224  Breast cancer
shr05225  Hepatocellular carcinoma
shr05226  Gastric cancer
shr05230  Central carbon metabolism in cancer
shr05231  Choline metabolism in cancer
shr05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:shr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100917396 (MAP2K2)
   04012 ErbB signaling pathway
    100917396 (MAP2K2)
   04014 Ras signaling pathway
    100917396 (MAP2K2)
   04015 Rap1 signaling pathway
    100917396 (MAP2K2)
   04370 VEGF signaling pathway
    100917396 (MAP2K2)
   04371 Apelin signaling pathway
    100917396 (MAP2K2)
   04066 HIF-1 signaling pathway
    100917396 (MAP2K2)
   04068 FoxO signaling pathway
    100917396 (MAP2K2)
   04072 Phospholipase D signaling pathway
    100917396 (MAP2K2)
   04071 Sphingolipid signaling pathway
    100917396 (MAP2K2)
   04024 cAMP signaling pathway
    100917396 (MAP2K2)
   04022 cGMP-PKG signaling pathway
    100917396 (MAP2K2)
   04151 PI3K-Akt signaling pathway
    100917396 (MAP2K2)
   04150 mTOR signaling pathway
    100917396 (MAP2K2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100917396 (MAP2K2)
  09143 Cell growth and death
   04210 Apoptosis
    100917396 (MAP2K2)
   04218 Cellular senescence
    100917396 (MAP2K2)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100917396 (MAP2K2)
   04550 Signaling pathways regulating pluripotency of stem cells
    100917396 (MAP2K2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100917396 (MAP2K2)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100917396 (MAP2K2)
   04650 Natural killer cell mediated cytotoxicity
    100917396 (MAP2K2)
   04660 T cell receptor signaling pathway
    100917396 (MAP2K2)
   04662 B cell receptor signaling pathway
    100917396 (MAP2K2)
   04664 Fc epsilon RI signaling pathway
    100917396 (MAP2K2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100917396 (MAP2K2)
   04929 GnRH secretion
    100917396 (MAP2K2)
   04912 GnRH signaling pathway
    100917396 (MAP2K2)
   04915 Estrogen signaling pathway
    100917396 (MAP2K2)
   04917 Prolactin signaling pathway
    100917396 (MAP2K2)
   04921 Oxytocin signaling pathway
    100917396 (MAP2K2)
   04926 Relaxin signaling pathway
    100917396 (MAP2K2)
   04935 Growth hormone synthesis, secretion and action
    100917396 (MAP2K2)
   04919 Thyroid hormone signaling pathway
    100917396 (MAP2K2)
   04916 Melanogenesis
    100917396 (MAP2K2)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100917396 (MAP2K2)
  09156 Nervous system
   04720 Long-term potentiation
    100917396 (MAP2K2)
   04730 Long-term depression
    100917396 (MAP2K2)
   04722 Neurotrophin signaling pathway
    100917396 (MAP2K2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100917396 (MAP2K2)
   05206 MicroRNAs in cancer
    100917396 (MAP2K2)
   05205 Proteoglycans in cancer
    100917396 (MAP2K2)
   05230 Central carbon metabolism in cancer
    100917396 (MAP2K2)
   05231 Choline metabolism in cancer
    100917396 (MAP2K2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100917396 (MAP2K2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100917396 (MAP2K2)
   05225 Hepatocellular carcinoma
    100917396 (MAP2K2)
   05226 Gastric cancer
    100917396 (MAP2K2)
   05214 Glioma
    100917396 (MAP2K2)
   05216 Thyroid cancer
    100917396 (MAP2K2)
   05221 Acute myeloid leukemia
    100917396 (MAP2K2)
   05220 Chronic myeloid leukemia
    100917396 (MAP2K2)
   05218 Melanoma
    100917396 (MAP2K2)
   05211 Renal cell carcinoma
    100917396 (MAP2K2)
   05219 Bladder cancer
    100917396 (MAP2K2)
   05215 Prostate cancer
    100917396 (MAP2K2)
   05213 Endometrial cancer
    100917396 (MAP2K2)
   05224 Breast cancer
    100917396 (MAP2K2)
   05223 Non-small cell lung cancer
    100917396 (MAP2K2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100917396 (MAP2K2)
   05022 Pathways of neurodegeneration - multiple diseases
    100917396 (MAP2K2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100917396 (MAP2K2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100917396 (MAP2K2)
   05135 Yersinia infection
    100917396 (MAP2K2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100917396 (MAP2K2)
   05170 Human immunodeficiency virus 1 infection
    100917396 (MAP2K2)
   05161 Hepatitis B
    100917396 (MAP2K2)
   05160 Hepatitis C
    100917396 (MAP2K2)
   05164 Influenza A
    100917396 (MAP2K2)
   05163 Human cytomegalovirus infection
    100917396 (MAP2K2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100917396 (MAP2K2)
   05165 Human papillomavirus infection
    100917396 (MAP2K2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100917396 (MAP2K2)
   01522 Endocrine resistance
    100917396 (MAP2K2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:shr01001]
    100917396 (MAP2K2)
Enzymes [BR:shr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     100917396 (MAP2K2)
Protein kinases [BR:shr01001]
 Serine/threonine kinases: STE group
  STE7 family
   100917396 (MAP2K2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal Kinase-like Kdo APH Seadorna_VP7
Other DBs
NCBI-GeneID: 100917396
NCBI-ProteinID: XP_031803704
Ensembl: ENSSHAG00000009251
LinkDB
Position
1
AA seq 400 aa
MLAKRKPVLPALNITPTIAEGPSPTSEGASEANLADLQKKLEELELDEQQKKRLEAFLTQ
KAKVGELKDDDFERISELGAGNGGVVTKVQHRPSGLIMARKLIHLEIKPAIRNQIIRELQ
VLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKEAKRIPEEILGKVSIAVLRG
LAYLREKHQIMHRDVKPSNILVNTRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQ
GTHYSVQSDIWSMGLSLVELSIGRYPIPPPDSKELEAIFGRPMVDGAEGEPHSISPRPKP
PGRPISGHGMDSRPAMAIFELLDYIVNEPPPKLPNGVFTQDFQEFVNKCLIKNPAERADL
KMLMNHTFIKRSEVEEVDFAGWLCKTLRLNQPSTPTRTAM
NT seq 1203 nt   +upstreamnt  +downstreamnt
atgctggccaagaggaagccggtgctgccggcgctcaacatcacccctaccatcgccgag
ggcccgtccccgaccagcgagggcgcgtccgaggcaaacttagcagatctgcagaaaaaa
ttagaagagctagaacttgatgagcagcagaaaaagcgactggaagctttcctcacccag
aaggcaaaggtgggagaactgaaggatgatgactttgagagaatctctgagctgggagct
ggcaatggtggagtggtcaccaaagtacaacatagaccctcaggcctcatcatggcccga
aagttaattcacctagagatcaaaccagcaattcggaaccagattatccgtgaactccag
gtcctacatgaatgcaattctccatacatcgtgggtttctatggtgccttttatagtgat
ggagagattagcatctgcatggaacacatggatggaggctctctggatcaggtattgaaa
gaggccaagagaattcctgaagaaatcttggggaaggttagcattgcggttcttcggggt
ttggcttatctaagagagaaacaccagattatgcacagagatgtgaaaccttctaacatt
ttggtcaatactcggggagagatcaagctctgtgactttggagtgagtgggcaactcata
gactctatggcaaattcctttgtaggaacccgatcctacatgtctccagagcggttacaa
ggcacccactactcagtccagtcagatatctggagtatgggcctgtccttagtagagctg
tccattggaaggtacccgattcccccgccagactccaaggaactagaagcgatatttggg
cggcccatggtcgatggggcagagggagaacctcacagcatctcaccacggccaaaaccc
ccaggacgtcccatcagtggtcatggaatggacagtcgacctgctatggccatctttgag
ctgttggactatattgttaatgagcctccacctaaactgccgaatggtgttttcacacaa
gatttccaggagtttgtaaataaatgcttaattaaaaacccagccgagagagcagatctg
aagatgctgatgaatcacacttttatcaaacggtcagaagtggaagaagtggattttgca
ggctggttatgtaaaactctgaggttaaaccagcccagcacccccacacgcactgccatg
tga

KEGG   Sarcophilus harrisii (Tasmanian devil): 100921899
Entry
100921899         CDS       T02286                                 

Gene name
MAP2K1
Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 1 isoform X1
  KO
K04368  mitogen-activated protein kinase kinase 1 [EC:2.7.12.2]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr01521  EGFR tyrosine kinase inhibitor resistance
shr01522  Endocrine resistance
shr04010  MAPK signaling pathway
shr04012  ErbB signaling pathway
shr04014  Ras signaling pathway
shr04015  Rap1 signaling pathway
shr04022  cGMP-PKG signaling pathway
shr04024  cAMP signaling pathway
shr04062  Chemokine signaling pathway
shr04066  HIF-1 signaling pathway
shr04068  FoxO signaling pathway
shr04071  Sphingolipid signaling pathway
shr04072  Phospholipase D signaling pathway
shr04114  Oocyte meiosis
shr04140  Autophagy - animal
shr04150  mTOR signaling pathway
shr04151  PI3K-Akt signaling pathway
shr04210  Apoptosis
shr04218  Cellular senescence
shr04270  Vascular smooth muscle contraction
shr04370  VEGF signaling pathway
shr04371  Apelin signaling pathway
shr04380  Osteoclast differentiation
shr04510  Focal adhesion
shr04540  Gap junction
shr04550  Signaling pathways regulating pluripotency of stem cells
shr04620  Toll-like receptor signaling pathway
shr04650  Natural killer cell mediated cytotoxicity
shr04660  T cell receptor signaling pathway
shr04662  B cell receptor signaling pathway
shr04664  Fc epsilon RI signaling pathway
shr04666  Fc gamma R-mediated phagocytosis
shr04668  TNF signaling pathway
shr04720  Long-term potentiation
shr04722  Neurotrophin signaling pathway
shr04725  Cholinergic synapse
shr04726  Serotonergic synapse
shr04730  Long-term depression
shr04810  Regulation of actin cytoskeleton
shr04910  Insulin signaling pathway
shr04912  GnRH signaling pathway
shr04914  Progesterone-mediated oocyte maturation
shr04915  Estrogen signaling pathway
shr04916  Melanogenesis
shr04917  Prolactin signaling pathway
shr04919  Thyroid hormone signaling pathway
shr04921  Oxytocin signaling pathway
shr04926  Relaxin signaling pathway
shr04928  Parathyroid hormone synthesis, secretion and action
shr04929  GnRH secretion
shr04934  Cushing syndrome
shr04935  Growth hormone synthesis, secretion and action
shr05010  Alzheimer disease
shr05022  Pathways of neurodegeneration - multiple diseases
shr05034  Alcoholism
shr05132  Salmonella infection
shr05135  Yersinia infection
shr05160  Hepatitis C
shr05161  Hepatitis B
shr05163  Human cytomegalovirus infection
shr05164  Influenza A
shr05165  Human papillomavirus infection
shr05166  Human T-cell leukemia virus 1 infection
shr05167  Kaposi sarcoma-associated herpesvirus infection
shr05170  Human immunodeficiency virus 1 infection
shr05200  Pathways in cancer
shr05205  Proteoglycans in cancer
shr05206  MicroRNAs in cancer
shr05210  Colorectal cancer
shr05211  Renal cell carcinoma
shr05212  Pancreatic cancer
shr05213  Endometrial cancer
shr05214  Glioma
shr05215  Prostate cancer
shr05216  Thyroid cancer
shr05218  Melanoma
shr05219  Bladder cancer
shr05220  Chronic myeloid leukemia
shr05221  Acute myeloid leukemia
shr05223  Non-small cell lung cancer
shr05224  Breast cancer
shr05225  Hepatocellular carcinoma
shr05226  Gastric cancer
shr05230  Central carbon metabolism in cancer
shr05231  Choline metabolism in cancer
shr05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:shr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100921899 (MAP2K1)
   04012 ErbB signaling pathway
    100921899 (MAP2K1)
   04014 Ras signaling pathway
    100921899 (MAP2K1)
   04015 Rap1 signaling pathway
    100921899 (MAP2K1)
   04370 VEGF signaling pathway
    100921899 (MAP2K1)
   04371 Apelin signaling pathway
    100921899 (MAP2K1)
   04668 TNF signaling pathway
    100921899 (MAP2K1)
   04066 HIF-1 signaling pathway
    100921899 (MAP2K1)
   04068 FoxO signaling pathway
    100921899 (MAP2K1)
   04072 Phospholipase D signaling pathway
    100921899 (MAP2K1)
   04071 Sphingolipid signaling pathway
    100921899 (MAP2K1)
   04024 cAMP signaling pathway
    100921899 (MAP2K1)
   04022 cGMP-PKG signaling pathway
    100921899 (MAP2K1)
   04151 PI3K-Akt signaling pathway
    100921899 (MAP2K1)
   04150 mTOR signaling pathway
    100921899 (MAP2K1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100921899 (MAP2K1)
  09143 Cell growth and death
   04114 Oocyte meiosis
    100921899 (MAP2K1)
   04210 Apoptosis
    100921899 (MAP2K1)
   04218 Cellular senescence
    100921899 (MAP2K1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100921899 (MAP2K1)
   04540 Gap junction
    100921899 (MAP2K1)
   04550 Signaling pathways regulating pluripotency of stem cells
    100921899 (MAP2K1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100921899 (MAP2K1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100921899 (MAP2K1)
   04650 Natural killer cell mediated cytotoxicity
    100921899 (MAP2K1)
   04660 T cell receptor signaling pathway
    100921899 (MAP2K1)
   04662 B cell receptor signaling pathway
    100921899 (MAP2K1)
   04664 Fc epsilon RI signaling pathway
    100921899 (MAP2K1)
   04666 Fc gamma R-mediated phagocytosis
    100921899 (MAP2K1)
   04062 Chemokine signaling pathway
    100921899 (MAP2K1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100921899 (MAP2K1)
   04929 GnRH secretion
    100921899 (MAP2K1)
   04912 GnRH signaling pathway
    100921899 (MAP2K1)
   04915 Estrogen signaling pathway
    100921899 (MAP2K1)
   04914 Progesterone-mediated oocyte maturation
    100921899 (MAP2K1)
   04917 Prolactin signaling pathway
    100921899 (MAP2K1)
   04921 Oxytocin signaling pathway
    100921899 (MAP2K1)
   04926 Relaxin signaling pathway
    100921899 (MAP2K1)
   04935 Growth hormone synthesis, secretion and action
    100921899 (MAP2K1)
   04919 Thyroid hormone signaling pathway
    100921899 (MAP2K1)
   04928 Parathyroid hormone synthesis, secretion and action
    100921899 (MAP2K1)
   04916 Melanogenesis
    100921899 (MAP2K1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100921899 (MAP2K1)
  09156 Nervous system
   04725 Cholinergic synapse
    100921899 (MAP2K1)
   04726 Serotonergic synapse
    100921899 (MAP2K1)
   04720 Long-term potentiation
    100921899 (MAP2K1)
   04730 Long-term depression
    100921899 (MAP2K1)
   04722 Neurotrophin signaling pathway
    100921899 (MAP2K1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100921899 (MAP2K1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100921899 (MAP2K1)
   05206 MicroRNAs in cancer
    100921899 (MAP2K1)
   05205 Proteoglycans in cancer
    100921899 (MAP2K1)
   05230 Central carbon metabolism in cancer
    100921899 (MAP2K1)
   05231 Choline metabolism in cancer
    100921899 (MAP2K1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100921899 (MAP2K1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100921899 (MAP2K1)
   05212 Pancreatic cancer
    100921899 (MAP2K1)
   05225 Hepatocellular carcinoma
    100921899 (MAP2K1)
   05226 Gastric cancer
    100921899 (MAP2K1)
   05214 Glioma
    100921899 (MAP2K1)
   05216 Thyroid cancer
    100921899 (MAP2K1)
   05221 Acute myeloid leukemia
    100921899 (MAP2K1)
   05220 Chronic myeloid leukemia
    100921899 (MAP2K1)
   05218 Melanoma
    100921899 (MAP2K1)
   05211 Renal cell carcinoma
    100921899 (MAP2K1)
   05219 Bladder cancer
    100921899 (MAP2K1)
   05215 Prostate cancer
    100921899 (MAP2K1)
   05213 Endometrial cancer
    100921899 (MAP2K1)
   05224 Breast cancer
    100921899 (MAP2K1)
   05223 Non-small cell lung cancer
    100921899 (MAP2K1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100921899 (MAP2K1)
   05022 Pathways of neurodegeneration - multiple diseases
    100921899 (MAP2K1)
  09165 Substance dependence
   05034 Alcoholism
    100921899 (MAP2K1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100921899 (MAP2K1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100921899 (MAP2K1)
   05135 Yersinia infection
    100921899 (MAP2K1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100921899 (MAP2K1)
   05170 Human immunodeficiency virus 1 infection
    100921899 (MAP2K1)
   05161 Hepatitis B
    100921899 (MAP2K1)
   05160 Hepatitis C
    100921899 (MAP2K1)
   05164 Influenza A
    100921899 (MAP2K1)
   05163 Human cytomegalovirus infection
    100921899 (MAP2K1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100921899 (MAP2K1)
   05165 Human papillomavirus infection
    100921899 (MAP2K1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100921899 (MAP2K1)
   01522 Endocrine resistance
    100921899 (MAP2K1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:shr01001]
    100921899 (MAP2K1)
Enzymes [BR:shr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     100921899 (MAP2K1)
Protein kinases [BR:shr01001]
 Serine/threonine kinases: STE group
  STE7 family
   100921899 (MAP2K1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal Kinase-like Seadorna_VP7
Other DBs
NCBI-GeneID: 100921899
NCBI-ProteinID: XP_031811197
LinkDB
Position
2
AA seq 393 aa
MPKKKPMPIQLNPTPDGSTINGTSSAETNLEALQKKLEELELDEQQRKRLEAFLTQKQKV
GELKDDDFEKISELGAGNGGVVFKVSHKPSGLIMARKLIHLEIKPAIRNQIIRELQVLHE
CNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKKAGRIPEQILGKVSIAVIKGLTYL
REKHKIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQGTHY
SVQSDIWSMGLSLVEMAIGRYPIPPPDSKELELMFGCPMEGDAPETSPRPRTPGRPLSSY
GMDSRPPMAIFELLDYIVNEPPPKLPSGVFSLEFQDFVNKCLIKNPAERADLKQLMVHTF
IKRSDAEEVDFAGWLCSTIGLNQPSTPTHAAGV
NT seq 1182 nt   +upstreamnt  +downstreamnt
atgcccaagaagaagccgatgcccattcagctgaacccgaccccggatggctctacgatt
aacgggaccagctcagccgagaccaacctggaggcactgcagaagaagctggaggaatta
gaactcgatgaacagcagcgcaagcgtctggaggcttttctcacccagaaacagaaagtg
ggtgagctgaaggatgacgactttgagaagatcagtgaactgggagctgggaatggtggt
gtggtgttcaaagtttcccacaaaccctctggcctaatcatggcaaggaagctaattcat
ctggagatcaagccagcaattcggaaccagattatacgggaactgcaagtcctgcacgag
tgcaactctccatatattgtaggattttatggggccttttacagtgatggggagatcagt
atctgcatggagcatatggatggaggatctttggaccaggtccttaagaaagctggaaga
attcctgagcaaattttggggaaagttagcattgctgtaataaagggtcttacatatctg
agagagaagcataagataatgcatagagatgtcaagccatccaacatcttggtgaattca
cgtggggaaatcaagctttgtgattttggtgtcagtgggcagctgattgattccatggct
aattccttcgtgggcacgaggtcctatatgtcgccagaacgactccagggaactcactat
tcggtacaatcagacatctggagcatggggctttctttggtggagatggccattggacga
tatcccattccaccgccagattccaaggagctagaactgatgtttggctgtccaatggag
ggagatgcgcctgagacatcaccacgaccaagaactcctgggaggcccctcagttcttat
ggaatggatagccgaccaccaatggcaatttttgaactgttggattacatagtcaatgag
cctcctccaaagttgcccagtggagtctttagtctggaatttcaagattttgtgaataaa
tgcctaataaaaaatcctgctgagagagctgatttaaagcaacttatggttcacactttt
atcaagaggtctgatgctgaggaagttgattttgcaggttggctctgctccaccataggc
cttaaccagcctagcacaccaacccatgctgctggtgtctaa

DBGET integrated database retrieval system