KEGG   Sarcophilus harrisii (Tasmanian devil): 100917457Help
Entry
100917457         CDS       T02286                                 

Gene name
KMT5B
Definition
(RefSeq) histone-lysine N-methyltransferase KMT5B
  KO
K11429  histone-lysine N-methyltransferase SUV420H [EC:2.1.1.43]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:shr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    100917457 (KMT5B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:shr03036]
    100917457 (KMT5B)
Enzymes [BR:shr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100917457 (KMT5B)
Chromosome and associated proteins [BR:shr03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     100917457 (KMT5B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET
Motif
Other DBs
NCBI-GeneID: 100917457
NCBI-ProteinID: XP_023362319
LinkDB All DBs
Position
6
AA seq 848 aa AA seqDB search
MKWLGDSKNMVVNGRRNGGKLSNEHQPSQSKFQHAGKDALKAGRNAVERRSSRCSGASGF
EGQSRYVPSSGMSAKELCENDDLATSLVLDPYLGFQTHKMNTSAFPWRSSRHFTKSDSCP
HTHPVRFRPIKGRQEELKEVIERFKKDEHLEKAFKCLTSGEWARHYFLNKNKAQERLFKE
HVFIYLRMFATDSGFEILPCNRYSSEQNGAKIVATKEWKRNDKIELLVGCIAELSEIEEN
MLLRHGENDFSVMYSTRKNCAQLWLGPAAFINHDCRPNCKFVSTGRDTACVKALRDIEPG
EEISCYYGDGFFGENNEYCECYTCERRGTGAFKSRVGLPTPTPVINSKYGLRETDKRLNR
LKKLGDGSKNSDSQSVSSNTDADTTQEKADAAANRKPSVGVKKSSKNRSLTRPSSSVSRI
PAASNSTSSKLTPLHNPRVPKKLKRPVIKPLLSKIKLRNQCRRPEQKSSSRKLEVGNLVL
KEPKVVLYKNLPIKKDRASEGAGGAAAAGGCLTRHAAREHRQGPLNGAPEQDGESPCTYI
TRRSVRTRTGWKETSEPALEPSLPGSPPGTWTGPGPGTDTDATEPPTAHAVHDQQKAYES
TASPKGEGRSPKEDASTAKKKSRPGKLLKPFPKVEEPAPALDAPESDEAVPALVGSQPDR
GEPRDRAEGPAGRQDCTSAAAGGCSVGTPDHSRTKDNFRTAKSKKKRRITRYDAQLILEN
SSGIPKLTLRRRHDSSSKAHEQDAEGAGASKISIKLSKDHDKDSSLYVAKLNNGFSTGTG
GGSATKLKIQLKRDEEGRGPYAEELRENGLCCQETLSLLESRVDGDGYGQYPEESAEEVS
SEEEEEEE
NT seq 2545 nt NT seq  +upstreamnt  +downstreamnt
atgaagtggttgggagactccaagaacatggtcgtgaatggcaggagaaatggaggcaag
ttgtctaacgaacaccagccgagtcaatccaaatttcagcacgcgggaaaggacgccctg
aaagctggcagaaatgcagttgagaggaggtcaagcagatgtagcggtgcttcagggttc
gagggccagagtcgctatgttccttcttcggggatgtctgccaaggagctatgtgaaaat
gacgacctagccaccagcctggtgcttgacccctacctaggctttcagacccacaagatg
aacacgagcgcctttccttggaggagttccaggcacttcactaaatcggacagctgccct
cacacgcacccggtgagatttcgtcctattaaaggaaggcaagaagagctgaaggaggtg
attgagcgctttaagaaagacgagcacttggagaaggccttcaaatgcctgacctcgggc
gaatgggcacggcactattttctgaacaagaataaggcacaggagcggttgttcaaagaa
cacgtatttatttatttgcgaatgtttgcgactgacagtggatttgaaatcctgccgtgc
aatcgatattcttcagaacagaatggagccaaaatcgttgcgacaaaagagtggaaacgg
aacgacaagatcgagttgctggtggggtgtatcgctgaactctcggaaatagaggagaac
atgcttcttcgacatggagagaacgacttcagcgtcatgtactccaccaggaaaaactgt
gctcagctctggctcggtcccgccgcctttataaaccatgattgcagacctaactgtaag
tttgtctcgacgggtcgtgacaccgcctgtgtgaaggccttgagagacatcgagcccggg
gaggaaatctcctgttattatggagacgggtttttcggagaaaacaacgagtactgcgag
tgttacacttgtgaaagacggggaactggtgcttttaagtcgagagtggggcttcccacc
cccactcccgtcatcaacagtaaatacgggctgagagagaccgacaagcgcttaaaccgg
ctgaagaagctgggtgatggcagcaagaactcggacagccagtcggtcagctccaacacg
gacgcagacaccactcaggaaaaagccgacgcggctgctaacaggaaaccgtccgtcggc
gtaaagaagagcagcaagaaccgatcgctcacgcgcccgtcgtcgtcggtgtcgcggatc
ccggcggcctccaactctacctcatcgaaactcactcctctccacaatcccagggtacca
aagaaactgaaaaggcctgtcatcaagcctttgctctccaagataaagctcagaaaccag
tgccggcggccagagcagaagagctcctccagaaagctagaggtggggaacctggtcctc
aaggagcccaaggtggttctctacaaaaacttgcccattaaaaaggacagagcgtcggag
ggagcggggggtgccgccgcggccggcggctgcctcacccgccacgcggcccgggaacac
cggcaggggcccctgaacggggctcccgagcaggacggggagtccccctgcacctacatc
actcggaggtcagtgaggacgagaaccgggtggaaggagacctctgagcccgccctcgag
ccgagcctgccgggcagccctcccggcacctggacgggcccaggccccggcacagacacg
gacgccacggaaccacccaccgcccacgcggtgcatgaccagcaaaaagcctacgagtcc
actgcgtccccaaagggggagggcaggtctccaaaggaggacgccagcacggccaaaaag
aaatcacggccagggaagcttctgaaaccatttcccaaagtggaggagcccgcgccggcc
ctggacgcccccgagagcgacgaagcagtgcccgccctcgtcggctcacagcccgaccgc
ggggagcccagggacagagcagaggggcccgcgggccgccaggactgcacctccgccgcc
gcgggcgggtgttccgtggggacgcccgaccattccagaacgaaagacaactttagaact
gccaaaagcaaaaaaaaacggcgcatcacgaggtacgatgcgcagctgatcctggagaac
agctccgggatccccaaattgactctgcggcgccgccacgacagcagcagtaaggcgcac
gagcaggacgccgagggcgccggcgcctccaagatcagcatcaagctcagcaaggaccac
gacaaggacagcagcctctatgtggccaagctcaacaacggcttcagcactggcaccggc
ggcggcagcgccaccaagctgaagatccagctgaagcgcgacgaggagggccgcgggccc
tacgccgaggagctgcgtgagaacggcctctgctgccaggagacgctctccctgctggag
tcgcgcgtggatggcgacggctacgggcagtacccggaggagagcgcggaggaggtgtcc
tcggaggaggaggaggaggaagagg

DBGET integrated database retrieval system