KEGG   Sarcophilus harrisii (Tasmanian devil): 100917462
Entry
100917462         CDS       T02286                                 

Gene name
CCND1
Definition
(RefSeq) G1/S-specific cyclin-D1
  KO
K04503  G1/S-specific cyclin-D1
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr01522  Endocrine resistance
shr04068  FoxO signaling pathway
shr04110  Cell cycle
shr04115  p53 signaling pathway
shr04151  PI3K-Akt signaling pathway
shr04152  AMPK signaling pathway
shr04218  Cellular senescence
shr04310  Wnt signaling pathway
shr04340  Hedgehog signaling pathway
shr04371  Apelin signaling pathway
shr04390  Hippo signaling pathway
shr04510  Focal adhesion
shr04530  Tight junction
shr04630  JAK-STAT signaling pathway
shr04917  Prolactin signaling pathway
shr04919  Thyroid hormone signaling pathway
shr04921  Oxytocin signaling pathway
shr04933  AGE-RAGE signaling pathway in diabetic complications
shr04934  Cushing syndrome
shr05160  Hepatitis C
shr05162  Measles
shr05163  Human cytomegalovirus infection
shr05165  Human papillomavirus infection
shr05166  Human T-cell leukemia virus 1 infection
shr05167  Kaposi sarcoma-associated herpesvirus infection
shr05169  Epstein-Barr virus infection
shr05200  Pathways in cancer
shr05203  Viral carcinogenesis
shr05205  Proteoglycans in cancer
shr05206  MicroRNAs in cancer
shr05210  Colorectal cancer
shr05212  Pancreatic cancer
shr05213  Endometrial cancer
shr05214  Glioma
shr05215  Prostate cancer
shr05216  Thyroid cancer
shr05218  Melanoma
shr05219  Bladder cancer
shr05220  Chronic myeloid leukemia
shr05221  Acute myeloid leukemia
shr05222  Small cell lung cancer
shr05223  Non-small cell lung cancer
shr05224  Breast cancer
shr05225  Hepatocellular carcinoma
shr05226  Gastric cancer
shr05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:shr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100917462 (CCND1)
   04340 Hedgehog signaling pathway
    100917462 (CCND1)
   04390 Hippo signaling pathway
    100917462 (CCND1)
   04371 Apelin signaling pathway
    100917462 (CCND1)
   04630 JAK-STAT signaling pathway
    100917462 (CCND1)
   04068 FoxO signaling pathway
    100917462 (CCND1)
   04151 PI3K-Akt signaling pathway
    100917462 (CCND1)
   04152 AMPK signaling pathway
    100917462 (CCND1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100917462 (CCND1)
   04115 p53 signaling pathway
    100917462 (CCND1)
   04218 Cellular senescence
    100917462 (CCND1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100917462 (CCND1)
   04530 Tight junction
    100917462 (CCND1)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    100917462 (CCND1)
   04921 Oxytocin signaling pathway
    100917462 (CCND1)
   04919 Thyroid hormone signaling pathway
    100917462 (CCND1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100917462 (CCND1)
   05206 MicroRNAs in cancer
    100917462 (CCND1)
   05205 Proteoglycans in cancer
    100917462 (CCND1)
   05203 Viral carcinogenesis
    100917462 (CCND1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100917462 (CCND1)
   05212 Pancreatic cancer
    100917462 (CCND1)
   05225 Hepatocellular carcinoma
    100917462 (CCND1)
   05226 Gastric cancer
    100917462 (CCND1)
   05214 Glioma
    100917462 (CCND1)
   05216 Thyroid cancer
    100917462 (CCND1)
   05221 Acute myeloid leukemia
    100917462 (CCND1)
   05220 Chronic myeloid leukemia
    100917462 (CCND1)
   05218 Melanoma
    100917462 (CCND1)
   05219 Bladder cancer
    100917462 (CCND1)
   05215 Prostate cancer
    100917462 (CCND1)
   05213 Endometrial cancer
    100917462 (CCND1)
   05224 Breast cancer
    100917462 (CCND1)
   05222 Small cell lung cancer
    100917462 (CCND1)
   05223 Non-small cell lung cancer
    100917462 (CCND1)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100917462 (CCND1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100917462 (CCND1)
   04934 Cushing syndrome
    100917462 (CCND1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100917462 (CCND1)
   05162 Measles
    100917462 (CCND1)
   05160 Hepatitis C
    100917462 (CCND1)
   05163 Human cytomegalovirus infection
    100917462 (CCND1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100917462 (CCND1)
   05169 Epstein-Barr virus infection
    100917462 (CCND1)
   05165 Human papillomavirus infection
    100917462 (CCND1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100917462 (CCND1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 100917462
NCBI-ProteinID: XP_031797127
LinkDB
Position
6
AA seq 292 aa
MEHQLLCCEVETIRRAYLDANLLNDRALQTMLKAEETCSPSVSYFKCVQKDILPYMRKIV
ATWMLEVCEEQKCEEEVFPLAMNYLDRFLSLEPLKKSRLQLLGATCMFVASKMKETIPLT
AEKLCIYTDHSVRPEELLHMELLLVNKLKWHLAAMTPHDFIEHFLSKMPVLEENKQIIRK
HAQTFVALCATDVKFISNPPSMIAAGSVVAAVQGLHLGSTNSFLTYQRLTRFLSQVIKCD
PDCLRACQEQIEALLESSLRQAQQHSSSSVPKNMEEEGDLSYTPTDVRDVNI
NT seq 879 nt   +upstreamnt  +downstreamnt
atggagcaccagctgctgtgctgcgaggtggagaccattcgccgggcgtacctcgatgcc
aacctcctcaatgaccgggcgctgcagaccatgctcaaagccgaggagacgtgctcgccg
tccgtgtcgtacttcaagtgcgtgcagaaggacatcctcccctacatgcgcaagatcgtg
gccacctggatgctcgaggtgtgcgaggagcagaaatgcgaagaggaagttttccccctg
gctatgaactatctggaccggttcctgtccctggagccgctgaagaagagccggctgcag
ctgctgggggccacctgcatgttcgtggcgtccaagatgaaggagaccatccccctgacg
gccgagaagctgtgcatctacaccgaccactcggtgcggcccgaggagctgctgcacatg
gagctgctcctggtgaacaagctcaagtggcacttggctgccatgactccccacgacttc
atcgaacactttctgtccaagatgcccgtgctggaggagaacaagcagatcatccgcaag
cacgcgcagaccttcgtggccctctgtgctacagacgtgaaattcatttccaaccctccc
tccatgatcgcggcggggagcgtggtggccgccgtccagggcctgcacctgggaagcacc
aactccttcctcacctatcagcgtctcaccagattcctgtctcaagtcattaagtgcgac
ccggattgcttacgagcctgccaggagcagatcgaagccctcctggagtccagcctgcgc
caggcccagcagcacagctcatcctcggtacccaagaacatggaggaagagggggacctg
tcttacacgcccaccgacgtccgggacgtgaacatttga

DBGET integrated database retrieval system