KEGG   Sarcophilus harrisii (Tasmanian devil): 100917948
Entry
100917948         CDS       T02286                                 

Gene name
IL3RA
Definition
(RefSeq) interleukin-3 receptor subunit alpha isoform X1
  KO
K04737  interleukin 3 receptor alpha
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr04060  Cytokine-cytokine receptor interaction
shr04151  PI3K-Akt signaling pathway
shr04210  Apoptosis
shr04630  JAK-STAT signaling pathway
shr04640  Hematopoietic cell lineage
shr05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:shr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100917948 (IL3RA)
   04151 PI3K-Akt signaling pathway
    100917948 (IL3RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100917948 (IL3RA)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100917948 (IL3RA)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100917948 (IL3RA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100917948 (IL3RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:shr04050]
    100917948 (IL3RA)
   04090 CD molecules [BR:shr04090]
    100917948 (IL3RA)
Cytokine receptors [BR:shr04050]
 Interleukin receptor families
  IL3 receptor family
   100917948 (IL3RA)
CD molecules [BR:shr04090]
 Proteins
  100917948 (IL3RA)
SSDB
Motif
Pfam: IL6Ra-bind IL3Ra_N
Other DBs
NCBI-GeneID: 100917948
NCBI-ProteinID: XP_031814925
LinkDB
Position
3
AA seq 437 aa
MAYLIIFIWFSMLLSLTYSQTQKQEVTPAQGATSHWFALLIEDEATVASADFQSFKKGTG
AQSEVFSYATLQTSPDSPIKNITIDMKTMCLNWTNVENVNNITCTIKILSKVVSQKKAKN
NKCNIKGFYSWCQGVDFVIEGFAGKRFSKTVRLPQRGEEGTTKENVSCEIHDANFMDCKW
TVRKTPGDIHYQFFYSQSPRTFVGRECRNYKTESEGRHVRCHFDNLSEFPNPYPYHFLVT
GTSNGREVQCTDDNISLWDIEIFKPPNVTIYCKDLNCSLQWQTPKTIQLEKKNFDYQLQI
QKIDDKNRSPVVLNIDKITRYNYKINYGKYTVKIRTKKKYGNKNWSTWSETQEFAGHEVH
KDNLLPVLMVLLPGITFIIVLIVGYLCKRYYVIQKIFPPIPQIRDQVSDSFQKYVEVDWK
ENKMLPEQCKIEEIQIT
NT seq 1314 nt   +upstreamnt  +downstreamnt
atggcttatctgataatcttcatttggttctcaatgttactatctctaacatacagccaa
acacagaaacaggaggtcactcctgctcagggagccaccagtcattggtttgccttgttg
atagaagatgaagccactgttgcaagtgcagatttccagagtttcaagaaaggaaccggg
gcccaatcagaagttttctcatatgcaactcttcagacaagtccagattctcctattaaa
aacataactatagatatgaagacaatgtgtttgaattggaccaatgtggagaatgtgaat
aacatcacctgtactattaaaatcctctcaaaagtggtatctcagaagaaggcaaaaaac
aacaagtgcaacataaaaggtttctatagctggtgccaaggggtagactttgtaattgag
ggattcgctgggaaaagattttcaaaaacagtccgtcttccccaaagaggagaagaaggg
accactaaagaaaatgtatcctgtgagattcatgatgcaaatttcatggactgcaaatgg
acagtgagaaaaactccaggagatatccattatcaatttttttactcacaatccccacgg
acttttgtgggtagagaatgtcgaaattacaagacagagtctgaaggcagacatgttaga
tgtcattttgataacctctcagaattcccaaacccttacccatatcacttcctagtgact
ggaactagcaatggaagggaagtccagtgtactgatgacaacatttcactatgggatatt
gaaatatttaaaccaccaaatgtcaccatatactgcaaagatcttaattgtagtctgcag
tggcagacacccaaaacaatacaattggagaaaaaaaactttgactatcaacttcaaatt
caaaagattgatgacaaaaataggtctccagtggtccttaatattgataaaatcacaaga
tataattacaaaattaattatggaaaatatactgtgaaaataagaacaaaaaaaaagtat
ggtaataaaaattggagtacatggagtgagactcaagaatttgcaggtcatgaagtccat
aaagataatcttttgccagtattaatggtgttacttcctggaattactttcattatagtg
ctcattgtgggctatctctgtaaaaggtattatgtgattcaaaaaatattccctcctatc
ccccaaatcagagaccaagtcagtgacagttttcaaaaatatgtcgaggtggactggaaa
gaaaataaaatgcttccagaacaatgtaaaattgaagagatacagatcacgtaa

DBGET integrated database retrieval system