KEGG   Sarcophilus harrisii (Tasmanian devil): 100918319
Entry
100918319         CDS       T02286                                 

Gene name
NCOA4
Definition
(RefSeq) nuclear receptor coactivator 4
  KO
K09289  nuclear receptor coactivator 4
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr04216  Ferroptosis
shr05200  Pathways in cancer
shr05216  Thyroid cancer
Brite
KEGG Orthology (KO) [BR:shr00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04216 Ferroptosis
    100918319 (NCOA4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100918319 (NCOA4)
  09162 Cancer: specific types
   05216 Thyroid cancer
    100918319 (NCOA4)
SSDB
Motif
Pfam: ARA70
Other DBs
NCBI-GeneID: 100918319
NCBI-ProteinID: XP_003755235
Ensembl: ENSSHAG00000007412
UniProt: G3VZF1
LinkDB
Position
2
AA seq 620 aa
MNISQDQSGSSSNKEPLARCCEARKELEHAIGGVLRAEQHIKDNLREVKAQIHSCISRHL
ECLRSREVWLYEQVDLIYQLKEETLQQQAQQLYWLLGQFNCLIHQLECTRSKDLANQVSV
CLERLGSLTLKPEDSTVLLFEADTASLRQTITTFGSLKTMQIPEHLMTCAASPNPGPPVE
RRASFPKQEQKPSSRPSFIPLRDWLLGSKPASTRQSPYVPSTNPQDWLNKKSALTSSQGS
SQTCNFNISNIWGNFKGLENWLHKQDVSEKRIPSKRKSSFSTASLQGPDLELPEQEEMDL
SDWLVTSPDPENGNFESDDKSKLFRLFKEDYNASDWLLKPGSCTNCQGNQPKGVEIENLG
NLKCLNEHLEGKKTAFSSLTPSENWLVQHHQVPFKVEEVCKANEPCTSFSECVCEDQCEK
EALCKWLLKKEGKDKNGVPMDQLPVLKSEPAKLKPSLNMWLCPSRDEAEEQAKTPKPAPC
TIPEPLKILLDSSLSDWLVKTKPKEIRVQEANSPDDKVPQEGLSPAKQMRPNPMTIWHCP
INAADWILPSKNTGSSSQPPGEDKWLLRKKAQEAFLNSPLREEHPFPQDHYGLPAVCDLF
ACMQLKVDKDKWLYRTPVQI
NT seq 1863 nt   +upstreamnt  +downstreamnt
atgaatatatcacaggaccagagtggcagttccagcaataaagagcccctggccaggtgc
tgtgaagcccgtaaggaattggagcatgccattggtggtgttctcagggctgaacagcac
attaaagacaacttgagagaagttaaagctcagattcacagctgcataagccgtcaccta
gaatgtttgcgcagccgtgaggtgtggttgtatgaacaggtggatctcatctatcagctt
aaagaagaaacacttcagcagcaagctcagcagctctattggttactgggacaattcaat
tgtcttattcaccagttggaatgtacccgtagtaaggatctagccaatcaagtttctgtg
tgcttggagaggctgggtagcttgaccctcaaacctgaagattccactgtcctgctgttt
gaggctgatacagcttctctgcgtcagaccatcactacatttggctctctcaaaaccatg
caaattcccgagcacttgatgacttgtgctgcttcacccaatcctgggccacctgtagag
agaagggcttcttttcccaagcaggagcagaaaccatcatctcgtccttcatttattcca
cttcgtgactggctccttggaagcaaacctgcctcaactcgtcagtctccttatgtacct
agtaccaaccctcaagattggcttaacaaaaagtcagctttgacaagcagccagggttcc
tcccaaacctgcaactttaatatcagtaacatctggggcaacttcaagggcttggaaaat
tggctccacaagcaagatgtttctgagaaaagaattccctcaaagcgtaaaagctccttc
tctacggcctctctacaggggcctgacctagagctccctgagcaagaagaaatggatctt
tctgattggctggttacctctcctgaccctgagaatggtaactttgaatcagatgataag
tcaaagctttttcgacttttcaaggaagattataatgcaagtgattggcttctcaagcct
ggttcctgcaccaactgtcagggcaaccagcccaaaggtgtagagattgaaaatttggga
aatctgaagtgcctgaatgagcacctggaagggaagaagacagcattttcctccctcaca
ccaagtgagaattggcttgttcagcatcatcaggttccttttaaagttgaggaggtgtgc
aaagctaatgagccttgtactagcttttccgagtgtgtttgtgaagaccaatgtgagaag
gaggccttgtgtaagtggctcctgaaaaaggaaggaaaggataaaaatggtgtcccaatg
gatcaactgccagttttgaaatctgagccagcaaagctgaaaccctccttgaatatgtgg
ctttgtccctctagggatgaggcagaggaacaggctaagacaccaaagccagctccttgt
acaattcctgaacccctcaagatcttgctggacagctccttgtcagattggcttgtcaaa
acaaaacccaaagaaataagagtacaggaagcaaacagtccggatgacaaagttccccag
gagggcctgtcaccagccaaacaaatgcgacctaaccccatgaccatttggcactgtcca
attaatgcagctgattggatattgccttcaaagaacacaggaagctctagccagccccct
ggggaagacaagtggttacttcgaaagaaggcccaggaagcattcctcaattcaccccta
cgagaagaacatccctttccccaagaccattatggcctgccagcagtttgtgatcttttt
gcctgtatgcagcttaaagtcgacaaagacaagtggttgtaccgaacccctgtccagata
tga

DBGET integrated database retrieval system