KEGG   Sarcophilus harrisii (Tasmanian devil): 100918400Help
Entry
100918400         CDS       T02286                                 

Gene name
GYS2
Definition
(RefSeq) glycogen [starch] synthase, liver
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr00500  Starch and sucrose metabolism
shr01100  Metabolic pathways
shr04151  PI3K-Akt signaling pathway
shr04152  AMPK signaling pathway
shr04910  Insulin signaling pathway
shr04922  Glucagon signaling pathway
shr04931  Insulin resistance
Module
shr_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:shr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    100918400 (GYS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100918400 (GYS2)
   04152 AMPK signaling pathway
    100918400 (GYS2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100918400 (GYS2)
   04922 Glucagon signaling pathway
    100918400 (GYS2)
 09160 Human Diseases
  09167 Endocrine and metabolic diseases
   04931 Insulin resistance
    100918400 (GYS2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:shr01003]
    100918400 (GYS2)
Enzymes [BR:shr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     100918400 (GYS2)
Glycosyltransferases [BR:shr01003]
 Polysaccharide
  Storage polysaccharide
   100918400 (GYS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glycos_transf_1 Glyco_trans_1_4 Glyco_transf_4 Glyco_trans_4_4
Motif
Other DBs
NCBI-GeneID: 100918400
NCBI-ProteinID: XP_003771206
Ensembl: ENSSHAG00000015521
UniProt: G3WS78
LinkDB All DBs
Position
5
AA seq 701 aa AA seqDB search
MLRGRSLSVTSLSGLPMWDVQELPIEDLLLFEVAWEVTNKVGGIYTVIQTKAKTTADEWG
ENYYLIGPYFEHNMKTQVEECEPPNQAIKKAMDAMNLHGCQVHFGRWLIEGSPYVVLFDI
GYSSWNLDRWKGDLWEACHIGIPYHDREASDMLIFGSLTAWFLKEVTDHANGKHVIVQFH
EWQAGTGLILSRARRLPIATIFTTHATLLGRYLCAANADFYNHLDKFDIDKEAGERQIYH
RYCMERASVHCAHVFTTVSEITAIEAEHMLKRKPDVVTPNGLNIKKFSAVHEFQNLHALY
KSRIQDFVRGHFYGHLDFDLEKTLFLFIAGRYEFSNKGADIFLEALSRLNFLLRVHKSDV
TVVVFFIMPAKTNNFNVETLKGQAVRKQLWDTANSVKEKFGKKLYDALLRGEIPDLNKIL
DRDDVTIMKRAIFSTQRQSLPPVTTHNMIDDSTDPILSTIRRIGLFNSRTDRVKVILHPE
FLSSTSPLLPMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMQE
HVTDPAAYGIYIVDRRFCSPDESCNQLTQFLYGFCKQSRRQRIIQRNRTERLSDLLDWKY
LGRYYMHARHLTLSRAFPDKFHAESSPSLATQGFKFPRPSSVPPSPTSSQHSSPHNSDVE
DEDERYDEEEEAERDRMNIKSPFSLGQVPHEKKKQHGEHKN
NT seq 2106 nt NT seq  +upstreamnt  +downstreamnt
atgttgcgaggaagatcactgtctgtgacctccctgagtgggctgcctatgtgggatgtg
caagaacttccaatagaggatctgctgttatttgaagttgcctgggaagtgaccaataaa
gttggtggcatctatactgtaatccagactaaggcaaaaacaacagcagatgaatgggga
gaaaattattatctgattggtccatactttgagcacaatatgaagacccaagtggaagag
tgtgagcctccaaaccaagcaattaaaaaagcaatggatgcaatgaatttgcatggatgt
caggttcatttcggaaggtggctcatagaagggagcccgtatgtggtattgtttgacatt
ggatattcttcttggaatttggacagatggaaaggagacctctgggaagcatgccacata
ggaatcccttaccacgaccgggaagctagtgatatgcttatatttggatcattaactgct
tggttcttaaaggaggtgactgaccatgcgaatggtaaacatgtcattgttcaatttcat
gaatggcaggcaggaactggactaattctttctagagccaggagacttcctattgccaca
atatttacaactcatgcaacactgcttggaaggtacctctgtgcagctaatgctgatttc
tacaatcaccttgataagtttgatatagacaaggaagctggagagagacagatttaccat
cggtactgcatggaacgagcttctgttcattgtgctcacgtgttcaccacggtttctgaa
atcactgccatagaagctgaacacatgctgaaaagaaagcctgatgttgttactccaaat
ggcctgaacattaagaaattttcagctgtgcatgagtttcaaaatttgcatgctttgtac
aagtccaggatccaggattttgttcgtggtcatttctatggtcatcttgattttgacctt
gaaaagactttattccttttcattgcggggagatatgaattttcaaacaaaggagctgat
atcttcttagaagctttatccagactaaacttcctcttacgggtacacaaaagtgatgtc
acagttgtggtgttttttattatgcctgccaagacaaataatttcaatgtggaaaccttg
aaagggcaagcagtgagaaagcaactatgggatacagcaaattcagtgaaagaaaagttt
ggaaagaaactctatgatgcactgctaagaggagaaattcctgatttgaacaagattttg
gatcgagatgatgtgacaattatgaaaagagccatcttttccactcagcgacaaagtttg
cctccagtgactactcataacatgattgatgattccacagatcccattctcagtaccatt
cggcgaattggacttttcaatagccggacagacagagtcaaggtgattttacatccagaa
ttcctttcctcaacaagtccattattacctatggattatgaagaattcgtcagaggctgc
catcttggagtatttccatcatactatgaaccctggggttatactcctgctgagtgcaca
gtgatgggcattcctagtgtgacaacaaacctgtctggcttcggctgtttcatgcaggaa
cacgtaactgacccagctgcttatggtatttacattgttgatcggaggttctgctcacca
gatgagtcctgcaatcagcttactcagtttctatatggattctgcaaacaatctcgtcgc
cagagaattatccagagaaatagaactgagagactttctgatttgctggactggaaatac
ttaggcaggtattacatgcatgccagacacttgacgctgagcagagcttttccagataaa
tttcatgctgaatcttcaccatcactagcgacccaaggttttaaatttccaaggccttct
tcagtgccaccttcacccacaagctctcaacattccagtcctcataacagtgatgtagaa
gatgaggacgagagatatgatgaagaagaagaagctgaaagggatcggatgaatatcaaa
tctcccttttctctgggtcaagtcccccatgaaaagaaaaagcaacatggggaacataag
aattga

DBGET integrated database retrieval system