KEGG   Sarcophilus harrisii (Tasmanian devil): 100918404
Entry
100918404         CDS       T02286                                 

Gene name
RBX1
Definition
(RefSeq) E3 ubiquitin-protein ligase RBX1
  KO
K03868  E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr03420  Nucleotide excision repair
shr04066  HIF-1 signaling pathway
shr04110  Cell cycle
shr04114  Oocyte meiosis
shr04120  Ubiquitin mediated proteolysis
shr04141  Protein processing in endoplasmic reticulum
shr04310  Wnt signaling pathway
shr04350  TGF-beta signaling pathway
shr04710  Circadian rhythm
shr05170  Human immunodeficiency virus 1 infection
shr05200  Pathways in cancer
shr05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:shr00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100918404 (RBX1)
   04120 Ubiquitin mediated proteolysis
    100918404 (RBX1)
  09124 Replication and repair
   03420 Nucleotide excision repair
    100918404 (RBX1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100918404 (RBX1)
   04350 TGF-beta signaling pathway
    100918404 (RBX1)
   04066 HIF-1 signaling pathway
    100918404 (RBX1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100918404 (RBX1)
   04114 Oocyte meiosis
    100918404 (RBX1)
 09150 Organismal Systems
  09159 Environmental adaptation
   04710 Circadian rhythm
    100918404 (RBX1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100918404 (RBX1)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    100918404 (RBX1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100918404 (RBX1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:shr04121]
    100918404 (RBX1)
   03400 DNA repair and recombination proteins [BR:shr03400]
    100918404 (RBX1)
Enzymes [BR:shr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.32  cullin-RING-type E3 NEDD8 transferase
     100918404 (RBX1)
Ubiquitin system [BR:shr04121]
 Ubiquitin ligases (E3)
  UBL E3 ligases
   100918404 (RBX1)
  Multi subunit Ring-finger type E3
   SCF complex
    Ring finger protein
     100918404 (RBX1)
   ECV complex
     100918404 (RBX1)
   Cul3 complex
     100918404 (RBX1)
   Cul4 complex
     100918404 (RBX1)
   Cul7 complex
     100918404 (RBX1)
   Cul9 complex
     100918404 (RBX1)
DNA repair and recombination proteins [BR:shr03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     Cul4-DDB2 complex
      100918404 (RBX1)
    TCR (transcription coupled repair) factors
     Cul4-CSA complex
      100918404 (RBX1)
SSDB
Motif
Pfam: zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4_2 zf-C3HC4 zf-RING_11 zf-C3HC4_3
Other DBs
NCBI-GeneID: 100918404
NCBI-ProteinID: XP_003772281
Ensembl: ENSSHAG00000004340
UniProt: G3VP49
LinkDB
Position
5
AA seq 108 aa
MAAAMDVDTPSGTNSGAGKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQ
ASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH
NT seq 327 nt   +upstreamnt  +downstreamnt
atggcggcggcgatggatgtggacacccccagtggcaccaacagcggcgccggcaagaag
cgctttgaagtgaaaaagtggaatgcggtagctctctgggcctgggatattgtggtggac
aactgtgccatctgcaggaaccacattatggacctttgtatagaatgtcaagccaatcag
gcatccgccacctctgaagaatgtactgtcgcatggggagtctgcaatcacgccttccac
ttccactgcatctctcgctggctcaaaaccaggcaggtgtgcccgctggacaacagagag
tgggagtttcaaaagtatgggcattag

DBGET integrated database retrieval system