KEGG   Sarcophilus harrisii (Tasmanian devil): 100918418Help
Entry
100918418         CDS       T02286                                 

Definition
(RefSeq) neutral alpha-glucosidase C
  KO
K12317  neutral alpha-glucosidase C [EC:3.2.1.20]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr00052  Galactose metabolism
shr00500  Starch and sucrose metabolism
shr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:shr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    100918418
   00500 Starch and sucrose metabolism
    100918418
Enzymes [BR:shr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     100918418
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 Gal_mutarotas_2 NtCtMGAM_N DUF5110
Motif
Other DBs
NCBI-GeneID: 100918418
NCBI-ProteinID: XP_003756097
Ensembl: ENSSHAG00000006638
LinkDB All DBs
Position
1
AA seq 866 aa AA seqDB search
MEAAGGEDAISFQDEAVDKSIFKDCSKIGFYRRQKLIPRKNTYRALLDSVTSGKDSTKFQ
IINEVNKVPLLAEVYGIEGNIFRFKISEIAPLKPRYEVSDVLIQKPVTKRLTPCTEDTGV
LVLKDDSVNLKFHITANPFTIDLISEDEPVLSINSMGQLYFEHLQMPPKHRPSTECKEDV
STDPSQESQDDLGLWQEKFGKFVDIKANGPSSIGIDFSLHGFEHLYGIPQHEETHQLKNT
GDTEAYRLYNLDVYGYKLHDKLGIYGSIPYLLAHKLDRTIGIFWLNASETLVEINIQPTI
EHTLSPKGSVLAKQKVKPRADVRWMSESGIIDVFILMGPTPAAVFKQYSILTGTQALPPL
FSLGYHQCRWNYNDEQDVKDVDAGFDDHDIPYDVIWLDIEHTEGKRYFTWDKKKFPNPKR
MQELIKSKKRKIVVISDPHIKVDPMYSLYSQAKEKGYFVKNNKGGDFEGICWPGASSYLD
FTNPRVREWYSSLFAFSEYEQMATAQGLIQRSKGKERPFVLTRSFFAGSQKYGAVWTGDN
VSEWGYLKFSIPMLLTLSVAGIPFCGADVGGFIGDPEPELLVRWYQAGAYQPFFRGHATM
NTKRREPWLFGEEHTKLIREAIKERYALLPYWYTLFYRAHVTSEPVMRPLWVEFPKELET
FSVEDEYMLGSALLIHPITEPKITMVDVFLPGFEEVWYDFRTFVHWEGARTLKVPIALDR
IPVFQRGGSVVPMKTALGRSTGWMTHLPYELLVALDTKGSAKGELYLDDGHSFQYLHQKQ
FLHRKFLFCDGILSSSCADENGHYHSECVVEKVLILGINKQPSSVTTSSSDGQEKQVVFT
YCSKTAVLHLEKLSLNVGANWEIHVK
NT seq 2601 nt NT seq  +upstreamnt  +downstreamnt
atggaagcggctggcggcgaagacgccatcagctttcaagatgaagctgtggataaaagc
atctttaaagactgcagcaaaattggtttttacagacgtcagaagctaatcccaaggaag
aatacctatcgggcattactggactcagttacatcaggcaaagacagcaccaaattccag
atcatcaatgaagtgaataaggttcctctcttggctgaagtctatggaatagagggaaac
attttcagatttaaaatcagtgaaatagctcctttgaaaccaaggtatgaagtctctgat
gttcttatacagaaaccagtcaccaaaaggctgaccccatgtacagaggatacaggtgtt
ctggttctgaaagatgattcagtaaacctgaaatttcacattacagccaaccccttcaca
atagatttgatttctgaagatgagcctgtgctgagtatcaattccatgggccagctatat
tttgaacatttgcagatgcctcccaaacacagaccttccacagaatgtaaggaagatgtg
tccactgatccttcccaggaaagtcaagatgatctgggtctttggcaagagaaatttggc
aaatttgtggatatcaaagccaatggtcctagctccataggcattgacttctccttgcat
ggttttgagcatctctatgggataccacaacatgaagaaacccatcaactcaaaaatact
ggtgatactgaggcttaccgactttacaacttggatgtctatgggtataagctacatgac
aaattgggtatttatggttctataccctatctcctagcacacaaactagacagaactata
ggaattttctggctaaatgcctcagaaacgctggtggaaatcaacatacaacctacaata
gaacacacattgtccccaaaaggctcagttttggcaaaacagaaagtcaagcctcgagct
gatgtgcgttggatgtcagagagtggaatcattgatgtctttatattaatgggaccaacc
cctgctgcagtcttcaaacagtattcaatactcacaggcacccaagcgctgcctccgctc
ttctccttaggataccatcagtgccgttggaactacaatgatgaacaagatgtcaaagat
gttgatgctgggtttgatgaccatgacattccttatgatgtcatatggctggatatagaa
catactgagggtaaacgatacttcacatgggacaaaaagaaatttccaaatcctaagagg
atgcaagagctgatcaagagcaaaaagcgcaagattgtggtcatttctgatccccatatt
aaagttgatcccatgtactcattgtactctcaagcaaaagagaagggctactttgtgaaa
aataacaaaggtggagactttgagggtatatgttggcctggggcttcttcttacctggat
ttcacaaaccccagagtacgagaatggtattcaagtctttttgccttctctgaatatgag
caaatggctacagctcagggactgatccagaggtctaaagggaaggagagaccctttgtt
ttgacgcgttctttctttgctggatctcagaaatatggtgcagtatggacaggagacaac
gtatcagagtggggttacctgaaattttccatcccaatgttgttgactcttagcgttgct
ggtattcccttttgtggagctgatgtaggtggattcattggggatccagaaccagagttg
ctggtgcgctggtaccaggctggagcctatcagcccttcttccgaggccatgctaccatg
aacactaagcggcgtgaaccctggttgtttggagaggaacataccaagctcatcagagaa
gccatcaaagagagatatgccctcttgccttactggtatactttgttctaccgtgcacat
gtgacttctgaaccagtcatgaggcctctctgggtagaatttccaaaagaattagaaact
tttagtgtggaggatgagtacatgttaggaagtgctttgctaatacatccaatcacagaa
ccaaagatcacaatggttgatgtatttctgcccgggtttgaagaggtctggtatgacttt
cggacatttgttcattgggaaggagcacgtaccctgaaggttcccatagccttggataga
atacctgtgtttcagcgaggtggaagtgtggtacccatgaagactgctttagggagatcc
acaggatggatgacccatctcccatatgaactccttgttgctctggacaccaaaggctct
gcaaaaggtgaactctaccttgatgatggacattcattccaatacctccatcaaaagcag
ttccttcacaggaagtttttgttctgtgatggtattttgtcctccagctgtgcagatgaa
aacggtcattaccacagcgagtgtgtggtagaaaaagtcctgatcctgggcattaataag
cagccttcctctgtgactaccagttcttctgatgggcaggagaagcaggtggtttttacc
tactgctccaagacagccgtacttcatctggaaaaactttcattgaatgttggtgctaat
tgggagatccatgtcaagtga

DBGET integrated database retrieval system