KEGG   Sarcophilus harrisii (Tasmanian devil): 100918800Help
Entry
100918800         CDS       T02286                                 

Gene name
TMPRSS2
Definition
(RefSeq) transmembrane protease serine 2
  KO
K09633  transmembrane protease serine 2 [EC:3.4.21.-]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr05164  Influenza A
shr05202  Transcriptional misregulation in cancer
shr05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:shr00001]
 09160 Human Diseases
  09161 Cancers: Overview
   05202 Transcriptional misregulation in cancer
    100918800 (TMPRSS2)
  09162 Cancers: Specific types
   05215 Prostate cancer
    100918800 (TMPRSS2)
  09172 Infectious diseases: Viral
   05164 Influenza A
    100918800 (TMPRSS2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:shr01002]
    100918800 (TMPRSS2)
Enzymes [BR:shr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     100918800 (TMPRSS2)
Peptidases [BR:shr01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   100918800 (TMPRSS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin SRCR_2 Hepsin-SRCR DUF1986 SRCR Ldl_recept_a Trypsin_2
Motif
Other DBs
NCBI-GeneID: 100918800
NCBI-ProteinID: XP_003766419
Ensembl: ENSSHAG00000004952
UniProt: G3VR62
LinkDB All DBs
Position
3
AA seq 492 aa AA seqDB search
MALNSGPPAFGPYYENHGYQLENYPPRHLVNTNAYVPYPVPYCASAVPQYIPRVITDTST
PPAVHLQPKSSSGIVFTSKAKKIICVAISIGIILIGAVIATIFLWKFVKTTCPNSGIECG
TSGTCINPANWCDGISHCPSGEDENHCVRLYGPKFILQVYSSHNKSWYPVCHDDWNDFYG
KIACKDMGYNMNSFYSSQGITDNSGATSYMKLNLSAGNVDLYEKLYTSNVCFSKTVVSLR
CIECGTVIKVNQLNRIVGGTIAAPGEWPWQVSLHVQGIHVCGGSIITPEWIVTAAHCVEE
PLSSPRYWTAFAGLLRQSVMFYGSGYKVQKIISHPNYDSKTKNNDVALMKLQTPLIFNEK
IRPVCLPNPGMMFEPTQLCWISGWGATYEKGKTSDILNAVMVPIIESWRCNSRYVYNNMI
TPAMICAGYLKGKIDSCQGDSGGPLVTEKNSVWWLVGDTSWGSGCAKANRPGVYGNLTVF
TDWIYQQMQANR
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atggctttaaattcagggccaccagcatttggaccatactatgaaaaccatggttatcaa
ctggaaaactatcctccaagacatcttgtgaatactaatgcttatgtaccttacccagtt
ccatattgtgcttcagcagtgccacaatacattccaagagttattactgatacttcaaca
ccaccagctgtccatttacaaccaaaatcttcatctgggatagtgtttacttcaaaggcc
aagaaaataatatgtgttgccattagcattggaataatacttattggtgctgtgattgca
actatctttctttggaagtttgtgaaaactacctgcccaaattctggaatagaatgtgga
acttcaggaacttgtatcaatccagctaattggtgtgatggaatatcacattgtccaagt
ggggaagatgagaaccattgtgttcgcctctatggaccaaaatttattcttcaggtttac
tcatctcacaacaaatcctggtatcctgtatgccatgatgactggaatgatttctatgga
aaaatagcatgtaaagatatgggatataacatgaatagtttttactctagtcaaggaata
acagacaatagtggcgccacgagctacatgaagttgaacctgagtgctggaaatgtagac
ttatatgaaaaactctacaccagtaatgtttgtttctcaaaaacagtggtatctctccgc
tgcatagaatgtggcacagtgataaaggtgaaccaattaaacaggattgtaggtggaaca
attgctgctccaggggaatggccatggcaagttagccttcatgtccaaggtatccatgtc
tgtggtggttctattatcactcctgaatggattgtaacagcagctcattgtgtggaagaa
cctctttctagtccccggtattggacagcatttgcaggacttttgaggcagtctgtgatg
ttctatggaagtggatataaagtgcaaaaaataatttctcatccaaattatgattctaaa
accaagaacaatgatgttgctcttatgaagttgcaaacaccactaatatttaacgaaaaa
ataagaccagtatgtttgcctaacccaggaatgatgtttgaacctactcagttatgctgg
atatcaggatggggtgcaacttatgaaaaaggtaaaacttcagacatcttgaatgcagtt
atggtacccataatagaatcttggagatgtaatagccgatatgtctacaataacatgatc
acccctgccatgatttgtgctggttatctcaaagggaaaattgattcctgtcagggtgac
agtgggggtcctttagtcactgagaaaaattcagtgtggtggttggttggtgatacaagc
tggggatctggatgtgccaaggcaaacagacctggagtttacggaaacctgacagtattt
acagactggatttaccaacaaatgcaggcaaacaggtga

DBGET integrated database retrieval system