KEGG   Sarcophilus harrisii (Tasmanian devil): 100918959Help
Entry
100918959         CDS       T02286                                 

Gene name
ALDH2
Definition
(RefSeq) aldehyde dehydrogenase, mitochondrial
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr00010  Glycolysis / Gluconeogenesis
shr00053  Ascorbate and aldarate metabolism
shr00071  Fatty acid degradation
shr00280  Valine, leucine and isoleucine degradation
shr00310  Lysine degradation
shr00330  Arginine and proline metabolism
shr00340  Histidine metabolism
shr00380  Tryptophan metabolism
shr00410  beta-Alanine metabolism
shr00561  Glycerolipid metabolism
shr00620  Pyruvate metabolism
shr01100  Metabolic pathways
Module
shr_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:shr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100918959 (ALDH2)
   00053 Ascorbate and aldarate metabolism
    100918959 (ALDH2)
   00620 Pyruvate metabolism
    100918959 (ALDH2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    100918959 (ALDH2)
   00561 Glycerolipid metabolism
    100918959 (ALDH2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    100918959 (ALDH2)
   00310 Lysine degradation
    100918959 (ALDH2)
   00330 Arginine and proline metabolism
    100918959 (ALDH2)
   00340 Histidine metabolism
    100918959 (ALDH2)
   00380 Tryptophan metabolism
    100918959 (ALDH2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100918959 (ALDH2)
Enzymes [BR:shr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     100918959 (ALDH2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 100918959
NCBI-ProteinID: XP_023352779
LinkDB All DBs
Position
2
AA seq 517 aa AA seqDB search
MLRAAALLGPRLGRRFLSSTAAAAVPIPNEHPEIFYNKIFINNEWHDAVSKKTFPTINPS
TGDVICQVAEGDKADVDKAVKAAREAFRLGSPWRRMDASHRGRLLNRLADLIERDRAYLA
TLETLDNGKPYAISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDGDFFSYTRHEPIGVCG
QIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLTALYVANLIKEAGFPPGVVNIIPG
YGPTAGAALSSHMDVDKVAFTGSTEVGKLIQVAAGSSNLKRVTLELGGKSPNIILSDADL
DWAVEQAHFALFFNQGQCCCAGSRTFVQEDIYPEFVERSVARAKARVVGNPFDSRTEQGP
QVDQEQFKKILGYIDLGKQQGAKLLCGGGPASDRGFFIQPTIFGDVQDNMTIASEEIFGP
VMQILKFKTIEEVVERANGSTYGLAAAVFTRDLDKANYLSQALQAGTVWINCYDVFGAQS
PFGGYKMSGNGRELGEYGLQAYTEVKTVTVKVPQKNS
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgctccgggccgctgctctgctcgggccccgtctgggccgccgctttctgtcctcgacc
gctgcggccgccgtgcccatccccaacgagcaccccgaaatcttctacaacaagattttt
ataaacaacgagtggcatgatgctgtcagcaagaagacttttcccaccatcaacccatcc
actggagacgtgatctgccaagtggccgagggggacaaggcagacgtggacaaggcagta
aaagctgcaagagaggcatttcgcctgggctctccgtggaggagaatggacgcgtcacac
cgaggaaggctcttgaaccgactggcggacctgatcgagagggaccgggcttacttggcc
acgctggagaccttggacaacggcaaaccctacgccatctcctacctcgtggacttggac
atggttctcaagtgccttcggtattacgctggctgggctgacaagtaccacgggaagacc
atccccatcgatggggacttcttcagctacacacgccacgagcccatcggggtgtgcggc
cagatcattccatggaacttccccctgctgatgcaggcctggaaactaggcccagccctg
gccacggggaacgtggtggtgatgaaggtggccgagcagacccccctgaccgccctctac
gtggccaacctgatcaaggaggctggtttcccccccggagtggtcaacatcatccccggg
tacggtccaacggctggcgccgccctctcttcccacatggacgtggacaaggtggcgttc
actggctccaccgaggttgggaagctcatccaggtggccgcagggagcagcaacctgaag
agagtgaccctggagctgggcggcaagagccccaacatcatcctctcagacgctgacctg
gactgggctgtggagcaggcccatttcgccctgttcttcaaccagggccagtgctgctgc
gcgggctcccggaccttcgtgcaggaggacatctaccctgagttcgtggagaggagcgtg
gcccgggccaaggcgcgtgtggtggggaacccctttgacagccgcacggagcaggggccc
caggtggaccaagagcagtttaagaagattctgggctacatcgatttggggaaacagcag
ggggccaagctgctgtgcggaggggggcctgcctccgaccggggcttcttcatccagccc
accatctttggggacgtgcaggacaacatgaccatcgcctcggaggagatctttgggcca
gtgatgcagatcttgaagttcaagaccatcgaggaggtggtggagagagccaacggttcc
acatatgggctggctgcagccgtcttcaccagagacctggacaaagccaactacctgtcc
caggccctgcaggccggcacagtgtggatcaattgctatgatgtatttggggcacagtcc
ccatttggaggctacaagatgtctgggaatgggcgagagctgggcgagtatggcttgcag
gcgtacacagaagtgaaaactgtcaccgtcaaagttcctcagaagaattcataa

DBGET integrated database retrieval system