KEGG   Sarcophilus harrisii (Tasmanian devil): 100919026
Entry
100919026         CDS       T02286                                 

Gene name
MAX
Definition
(RefSeq) protein max isoform X5
  KO
K04453  Max protein
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr04010  MAPK signaling pathway
shr05200  Pathways in cancer
shr05202  Transcriptional misregulation in cancer
shr05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:shr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100919026 (MAX)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100919026 (MAX)
   05202 Transcriptional misregulation in cancer
    100919026 (MAX)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100919026 (MAX)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:shr03000]
    100919026 (MAX)
Transcription factors [BR:shr03000]
 Eukaryotic type
  Basic helix-loop-helix/leucine zipper (bHLH-ZIP)
   Cell cycle controlling factors, Mad/Max
    100919026 (MAX)
SSDB
Other DBs
NCBI-GeneID: 100919026
NCBI-ProteinID: XP_023358679
Ensembl: ENSSHAG00000014285
LinkDB
Position
2
AA seq 103 aa
MTSSGRMLYWSSKGKARADQVLCSWGIHFSSSLMEDASKRKFRALEKARSSAQLQTNYSS
SDSSLYTNAKGSTISAFDGGSDSSSESEPEEPQSRKKLRMEAS
NT seq 312 nt   +upstreamnt  +downstreamnt
atgacctcaagcggcagaatgctctactggagcagcaaggggaaagcgagagctgatcaa
gttctttgttcctggggaattcacttctcttcctccctcatggaagatgcaagtaaaagg
aaattccgtgcactggagaaagcgaggtcaagtgcccaactgcagaccaactattcttct
tcagacagcagcctctataccaatgccaagggcagcaccatctctgccttcgatgggggc
tctgattccagctctgagtcagagcctgaagagccccaaagcagaaagaaactccggatg
gaggccagctaa

DBGET integrated database retrieval system