KEGG   Sarcophilus harrisii (Tasmanian devil): 100919027
Entry
100919027         CDS       T02286                                 

Gene name
NFKBIA
Definition
(RefSeq) LOW QUALITY PROTEIN: NF-kappa-B inhibitor alpha
  KO
K04734  NF-kappa-B inhibitor alpha
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr04024  cAMP signaling pathway
shr04062  Chemokine signaling pathway
shr04064  NF-kappa B signaling pathway
shr04210  Apoptosis
shr04380  Osteoclast differentiation
shr04620  Toll-like receptor signaling pathway
shr04621  NOD-like receptor signaling pathway
shr04622  RIG-I-like receptor signaling pathway
shr04623  Cytosolic DNA-sensing pathway
shr04625  C-type lectin receptor signaling pathway
shr04657  IL-17 signaling pathway
shr04658  Th1 and Th2 cell differentiation
shr04659  Th17 cell differentiation
shr04660  T cell receptor signaling pathway
shr04662  B cell receptor signaling pathway
shr04668  TNF signaling pathway
shr04722  Neurotrophin signaling pathway
shr04920  Adipocytokine signaling pathway
shr04926  Relaxin signaling pathway
shr04931  Insulin resistance
shr05132  Salmonella infection
shr05134  Legionellosis
shr05135  Yersinia infection
shr05140  Leishmaniasis
shr05142  Chagas disease
shr05145  Toxoplasmosis
shr05160  Hepatitis C
shr05161  Hepatitis B
shr05162  Measles
shr05163  Human cytomegalovirus infection
shr05164  Influenza A
shr05166  Human T-cell leukemia virus 1 infection
shr05167  Kaposi sarcoma-associated herpesvirus infection
shr05168  Herpes simplex virus 1 infection
shr05169  Epstein-Barr virus infection
shr05170  Human immunodeficiency virus 1 infection
shr05171  Coronavirus disease - COVID-19
shr05200  Pathways in cancer
shr05203  Viral carcinogenesis
shr05215  Prostate cancer
shr05220  Chronic myeloid leukemia
shr05222  Small cell lung cancer
shr05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:shr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100919027 (NFKBIA)
   04668 TNF signaling pathway
    100919027 (NFKBIA)
   04024 cAMP signaling pathway
    100919027 (NFKBIA)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100919027 (NFKBIA)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100919027 (NFKBIA)
   04621 NOD-like receptor signaling pathway
    100919027 (NFKBIA)
   04622 RIG-I-like receptor signaling pathway
    100919027 (NFKBIA)
   04623 Cytosolic DNA-sensing pathway
    100919027 (NFKBIA)
   04625 C-type lectin receptor signaling pathway
    100919027 (NFKBIA)
   04660 T cell receptor signaling pathway
    100919027 (NFKBIA)
   04658 Th1 and Th2 cell differentiation
    100919027 (NFKBIA)
   04659 Th17 cell differentiation
    100919027 (NFKBIA)
   04657 IL-17 signaling pathway
    100919027 (NFKBIA)
   04662 B cell receptor signaling pathway
    100919027 (NFKBIA)
   04062 Chemokine signaling pathway
    100919027 (NFKBIA)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    100919027 (NFKBIA)
   04926 Relaxin signaling pathway
    100919027 (NFKBIA)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100919027 (NFKBIA)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100919027 (NFKBIA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100919027 (NFKBIA)
   05203 Viral carcinogenesis
    100919027 (NFKBIA)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100919027 (NFKBIA)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    100919027 (NFKBIA)
   05215 Prostate cancer
    100919027 (NFKBIA)
   05222 Small cell lung cancer
    100919027 (NFKBIA)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100919027 (NFKBIA)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100919027 (NFKBIA)
   05135 Yersinia infection
    100919027 (NFKBIA)
   05134 Legionellosis
    100919027 (NFKBIA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100919027 (NFKBIA)
   05170 Human immunodeficiency virus 1 infection
    100919027 (NFKBIA)
   05161 Hepatitis B
    100919027 (NFKBIA)
   05160 Hepatitis C
    100919027 (NFKBIA)
   05171 Coronavirus disease - COVID-19
    100919027 (NFKBIA)
   05164 Influenza A
    100919027 (NFKBIA)
   05162 Measles
    100919027 (NFKBIA)
   05168 Herpes simplex virus 1 infection
    100919027 (NFKBIA)
   05163 Human cytomegalovirus infection
    100919027 (NFKBIA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100919027 (NFKBIA)
   05169 Epstein-Barr virus infection
    100919027 (NFKBIA)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100919027 (NFKBIA)
   05140 Leishmaniasis
    100919027 (NFKBIA)
   05142 Chagas disease
    100919027 (NFKBIA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:shr03000]
    100919027 (NFKBIA)
   04131 Membrane trafficking [BR:shr04131]
    100919027 (NFKBIA)
Transcription factors [BR:shr03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Ankyrin only
    100919027 (NFKBIA)
Membrane trafficking [BR:shr04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    100919027 (NFKBIA)
SSDB
Motif
Pfam: Ank Ank_2 Ank_3 Ank_5 Ank_4
Other DBs
NCBI-GeneID: 100919027
NCBI-ProteinID: XP_003756483
Ensembl: ENSSHAG00000003046
UniProt: G3VJW2
LinkDB
Position
2
AA seq 321 aa
MFHVLRQSQEESPQEHGMEGPXDGLKKERLLDDRHDSGLDSMKDEEYELMVKELKEIRIQ
PQEAHAGPPQESWKLQITEDGDTFLHLAIIHEEKTLSLEIIRQVGGDLAFLNSQNNLQQT
PLHLAVITKQPEIAEALLKAGCDPELRDFQGNTPLHLACEQGCLAGIGVLTQYCQIQDLL
SVLHSTNYNGHTCLHLASIHGYLAVVEHLVSLGADVNAQEPCNGRTALHLAVDLQNPELV
SLLLRCGADVNKVTYQGYSPYQLTWGRENTTIQKLLGQLTMENLQMLPESEDEESYDTEL
EFTEDELLYDDCVIGGQRLAL
NT seq 966 nt   +upstreamnt  +downstreamnt
atgtttcacgttttgaggcagtctcaggaggagagcccccaggagcacggcatggaaggc
cccngggacgggctcaaaaaggagcggcttttagatgatcgccacgatagcggcctggac
tcgatgaaagatgaggaatacgagctgatggtgaaagagctgaaggagatcaggattcag
cctcaggaggcgcatgccgggccgccccaggagtcttggaaactacagatcaccgaggac
ggagacacgtttctccacttggccatcattcacgaagagaagacgttgagtttggaaatc
atccgacaagtgggaggggatttggctttcctcaactctcagaacaatctgcaacagact
cctcttcacttggcagtgatcaccaaacagccagagattgctgaggcactcctaaaagct
ggctgtgacccagagctcagggactttcaagggaatacacctctgcaccttgcttgtgag
cagggctgcctggctggtataggagtgcttacccaatattgccaaatccaggacctcctc
tcagtgcttcattctacaaactacaatggtcacacatgcctccatttggcttccatccat
ggctacttagcagtagtggaacatttggtatccttgggagctgatgtcaatgctcaggag
ccctgtaatggccgaactgccctccatcttgctgtagacttgcagaatcctgaactggta
tcactccttttgaggtgtggggctgatgtcaacaaagtaacttaccagggttactctcca
tatcaactcacttggggcagagaaaatactacaattcaaaagcttttggggcagctgacc
atggaaaacttgcaaatgcttccagagagtgaagatgaagagagctatgatacagagttg
gaattcacagaggatgaattgctctatgatgactgtgtgattggaggccaacgactagca
ttatga

DBGET integrated database retrieval system