KEGG   Sarcophilus harrisii (Tasmanian devil): 100919206
Entry
100919206         CDS       T02286                                 

Gene name
PLCG2
Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-2 isoform X2
  KO
K05859  phosphatidylinositol phospholipase C, gamma-2 [EC:3.1.4.11]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr00562  Inositol phosphate metabolism
shr01100  Metabolic pathways
shr01521  EGFR tyrosine kinase inhibitor resistance
shr04012  ErbB signaling pathway
shr04014  Ras signaling pathway
shr04020  Calcium signaling pathway
shr04062  Chemokine signaling pathway
shr04064  NF-kappa B signaling pathway
shr04066  HIF-1 signaling pathway
shr04070  Phosphatidylinositol signaling system
shr04072  Phospholipase D signaling pathway
shr04360  Axon guidance
shr04370  VEGF signaling pathway
shr04380  Osteoclast differentiation
shr04611  Platelet activation
shr04613  Neutrophil extracellular trap formation
shr04625  C-type lectin receptor signaling pathway
shr04650  Natural killer cell mediated cytotoxicity
shr04662  B cell receptor signaling pathway
shr04664  Fc epsilon RI signaling pathway
shr04666  Fc gamma R-mediated phagocytosis
shr04670  Leukocyte transendothelial migration
shr04722  Neurotrophin signaling pathway
shr04750  Inflammatory mediator regulation of TRP channels
shr04919  Thyroid hormone signaling pathway
shr04933  AGE-RAGE signaling pathway in diabetic complications
shr04935  Growth hormone synthesis, secretion and action
shr05167  Kaposi sarcoma-associated herpesvirus infection
shr05169  Epstein-Barr virus infection
shr05170  Human immunodeficiency virus 1 infection
shr05171  Coronavirus disease - COVID-19
shr05200  Pathways in cancer
shr05205  Proteoglycans in cancer
shr05206  MicroRNAs in cancer
shr05214  Glioma
shr05223  Non-small cell lung cancer
shr05225  Hepatocellular carcinoma
Module
shr_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:shr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100919206 (PLCG2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100919206 (PLCG2)
   04014 Ras signaling pathway
    100919206 (PLCG2)
   04370 VEGF signaling pathway
    100919206 (PLCG2)
   04064 NF-kappa B signaling pathway
    100919206 (PLCG2)
   04066 HIF-1 signaling pathway
    100919206 (PLCG2)
   04020 Calcium signaling pathway
    100919206 (PLCG2)
   04070 Phosphatidylinositol signaling system
    100919206 (PLCG2)
   04072 Phospholipase D signaling pathway
    100919206 (PLCG2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100919206 (PLCG2)
   04613 Neutrophil extracellular trap formation
    100919206 (PLCG2)
   04625 C-type lectin receptor signaling pathway
    100919206 (PLCG2)
   04650 Natural killer cell mediated cytotoxicity
    100919206 (PLCG2)
   04662 B cell receptor signaling pathway
    100919206 (PLCG2)
   04664 Fc epsilon RI signaling pathway
    100919206 (PLCG2)
   04666 Fc gamma R-mediated phagocytosis
    100919206 (PLCG2)
   04670 Leukocyte transendothelial migration
    100919206 (PLCG2)
   04062 Chemokine signaling pathway
    100919206 (PLCG2)
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    100919206 (PLCG2)
   04919 Thyroid hormone signaling pathway
    100919206 (PLCG2)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100919206 (PLCG2)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100919206 (PLCG2)
  09158 Development and regeneration
   04360 Axon guidance
    100919206 (PLCG2)
   04380 Osteoclast differentiation
    100919206 (PLCG2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100919206 (PLCG2)
   05206 MicroRNAs in cancer
    100919206 (PLCG2)
   05205 Proteoglycans in cancer
    100919206 (PLCG2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100919206 (PLCG2)
   05214 Glioma
    100919206 (PLCG2)
   05223 Non-small cell lung cancer
    100919206 (PLCG2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100919206 (PLCG2)
   05171 Coronavirus disease - COVID-19
    100919206 (PLCG2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100919206 (PLCG2)
   05169 Epstein-Barr virus infection
    100919206 (PLCG2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100919206 (PLCG2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100919206 (PLCG2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:shr04131]
    100919206 (PLCG2)
Enzymes [BR:shr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100919206 (PLCG2)
Membrane trafficking [BR:shr04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    100919206 (PLCG2)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    100919206 (PLCG2)
SSDB
Motif
Pfam: PI-PLC-X SH2 PI-PLC-Y C2 SH3_1 SH3_9 PH SH3_2 PH_12 PH_14 EF-hand_like GDPD
Other DBs
NCBI-GeneID: 100919206
NCBI-ProteinID: XP_003757898
Ensembl: ENSSHAG00000011637
UniProt: G3WDW2
LinkDB
Position
2
AA seq 1264 aa
MTTKINLESLPEYEKSQIKRTLELGTVMTLFSLKKSNPERRTVQVITETRQVAWSKTADK
IEGFLDLMEIKEIRPGKNSKDFERGKASRQKEDCCFTIFYGTQFVLNTLSLAVDSKEDAN
KWLCGLTILHQEAQNASTPAIIESWLRKQIYSVDQTRRNSISFRELKTILPLVNFKVSSA
KFLKDKFLEIGAYKDELSFEQFHLFYKKMMFEQQKSILDEFKKDSSVFILGNTDRPDASA
VHLHDFQRFLLHEQQEIWAQDLSKVREQMTKFIDDTMRETAEPFLFVDEFLTYLFSKENS
IWDDKYDSVDMQDMNNPLSHYWISSSHNTYLTGDQLRSESSTESYIRCLRMGCRCIELDC
WDGPDGKPIIYHGWTRTTKIKFDDVVQAIRDHAFVSSQFPVILSIEEHCCVEQQRHMARV
FKDVFGDLLLTKPTEASADQLPSPAQLKEKIIIKHKKLGPRGDVDINIEDRKEEKKQQGE
LYMWDTIDQKWYRHYCAIADEKLSFSDVIEQNMEEDSAKDVAQTDLHFGEKWFHKRMEKR
TSAEKLLQEYCAETGGKDGTFLVRESETFPNDYTLSFWRSGRVQHCRIRSTPEGGAMKYY
LTDNLMFNSIYDLIQHYREAHLRCAEFELRLTDPVPNPNPHESKAWYYDSLSRGEAEDML
MRIPRDGAFLIRKREGGDAYAITFRAKGKVKHCRINKDGHHFVLGTSAYFESLVELVNYY
EKHALYRKMRLRYPVTPELLERYNTERDINSLYDVRMYVDPSEINPSTPQRTVKALYDYK
AKRGDELSFCRGALIHNVSKESGGWWKGDYGGRIQQYFPSNYVEDISTVDFEELEKQIIE
DNPLGSLCRGILDLNTYNVVKVPHGKNQKPFVFILEPKKPNDPPIEFATDKVEELFEWYQ
SIREITWKNATVENNMKYWEKNQSIAIELSDLVVYCKPTSKTKDNLENPDFREIRSFVET
KADSIVRQKPIDLLKYNQKGLTRVYPKGQRVDSSNYDPFRLWLCGSQMVALNFQTADKYM
QLNHALFALNGRTGYVLQPESMRNENYDPTPPESQRKILMTLTVKVLGARHLPKLGRSIA
CPFVEVEICGTEYDNNKFKTTVVNDNGLSPVWASTQEKVTFEIYDPNLAFLRFVVYEEDM
FSDPNFLAHATYPIKGIKSGFRSVPLKNGYSEDIELASLLVFCEMRPVLESEEELYSSCR
QLRRRQEELNNELFLYDSHQNLRNANRDALMNEFNVNENQLQLYQEKCNRRLREKRVSNS
KFYS
NT seq 3795 nt   +upstreamnt  +downstreamnt
atgaccaccaagatcaacttagagagtcttcctgaatatgagaagagtcagatcaagagg
accctggaattgggaactgtcatgaccctgtttagccttaagaaatctaaccctgagagg
agaacggtccaggtcatcacagagaccaggcaggtggcatggagtaagacggctgacaag
atcgaagggttcttggacctaatggagataaaggaaatccgcccagggaaaaactcaaag
gactttgaacgtgggaaagccagtcgccagaaagaagattgctgctttaccatattttat
ggcacccagtttgtgctcaacaccctgagtttagcagtggactccaaagaagatgctaat
aaatggctttgtggcttgacaattttgcaccaagaagcccagaatgcctcaacaccagct
attattgagagctggctaagaaagcaaatttattctgtagatcaaactcggagaaatagt
atcagcttcagagaactgaagaccattcttcctttagtaaacttcaaagtgagcagcgcc
aagttcctgaaagacaaattcctggaaataggtgcctacaaggatgaactcagctttgaa
cagttccacttattctacaaaaagatgatgtttgagcaacagaaatcaattcttgatgag
ttcaaaaaagattcatctgtgtttattctgggaaatacagatcggccagatgcatctgct
gttcacctgcatgacttccagaggtttctcctgcatgaacagcaggaaatctgggcacag
gatctaagtaaagtaagagagcagatgacaaaatttatagatgacactatgagagaaaca
gctgaaccattcctgtttgtcgatgagttcctcacttatctgttttcaaaagaaaacagc
atttgggatgataaatatgactctgttgatatgcaagacatgaataatcctttgtctcat
tattggatttcttcatctcataacacgtacctcactggagatcaacttcgaagtgaatct
tctactgaatcatacattcgatgtcttcgaatgggttgccggtgtatagagttggattgc
tgggatggacctgatggaaagccaatcatctatcatggctggacacgaacaacgaaaatc
aagtttgatgatgtggtgcaggccatcagagaccatgcttttgtctcctcacagttccca
gtgattctctccattgaagagcactgttgtgtagaacagcagcgtcatatggccagggta
tttaaagacgtgtttggggatctcctccttacaaaacccactgaagccagtgctgaccag
ctgccatcccctgcccagctgaaagaaaagatcatcattaagcacaagaagctgggtccc
agaggagatgtggacatcaacattgaagacagaaaagaagaaaaaaaacagcaaggggaa
ctatacatgtgggacaccattgatcagaagtggtatcgccactattgtgccatagctgat
gagaagttgtccttcagtgatgttatagagcagaatatggaagaagactcagcaaaggac
gtagcacagactgacctgcattttggtgagaagtggtttcataaaagaatggagaagagg
acaagtgctgagaaattactgcaagaatattgtgctgaaaccggaggaaaggatggaacc
ttcttagtccgtgaaagtgagactttccccaatgactacacattgtccttctggagatca
ggcagagtccagcactgtcgaatacggtcgactcctgagggaggggccatgaagtattat
ttgactgacaacctcatgttcaacagcatctatgacttgattcaacactaccgagaagcc
cacctaagatgtgctgaatttgaacttcgtttgacagacccagtgcccaatcccaatcct
catgaatcaaaagcttggtactatgatagcctgagcagaggagaagctgaagacatgttg
atgagaattccccgagatggagccttcctgattaggaaaagagaagggggagatgcatac
gccattactttcagagccaagggaaaagtgaaacactgccggattaacaaagatggacat
cactttgtgctggggacgtctgcttactttgaaagcttagtggaattggtcaactactat
gaaaagcatgcactctacaggaaaatgagattgcgctatcctgtgactccagagctgctg
gaacgttacaatactgaaagggacataaattcactttatgatgtcaggatgtatgtggat
cccagtgaaattaacccttcaacgcctcagagaactgtgaaggctttatacgactacaaa
gccaagcgtggggatgagctcagcttctgtcggggggccctcatccataatgtctccaag
gagtctggtggctggtggaagggtgattatggaggaaggattcagcaatattttccatct
aattatgtggaagacatatcaacagttgattttgaagagctggaaaaacagattattgaa
gataaccctttaggatctctgtgcagaggaatcttggatcttaacacctataatgttgtg
aaagtaccacatggaaaaaaccagaaaccatttgtcttcatcctggaacccaagaaaccc
aatgatcctcctatagagtttgcgactgacaaagtggaagagctctttgagtggtaccag
agcatcagggaaatcacctggaagaatgcaacagtggagaacaacatgaaatattgggag
aagaaccaatcgattgccatagaactatctgatttggttgtctactgtaagccaacaagt
aaaaccaaggataatttagaaaatcctgatttcagagaaattcgctctttcgtggagacc
aaagccgacagcattgttaggcagaagccaattgatcttttgaagtacaatcaaaaggga
ctgactcgggtctaccccaaaggtcaaagggtagactcatcaaattatgatccttttcga
ctttggctttgtggctcccagatggttgccctgaatttccagactgcagataaatatatg
cagctgaatcatgctttatttgcacttaatggtcggactggctacgtcctacagcctgaa
agcatgaggaatgaaaactatgatccaacacctccagagtcacaaagaaagatcctgatg
accttgacagtgaaggtcctgggggctcgtcatctacccaagcttggccgaagcattgcc
tgtccatttgtagaagtggaaatttgtgggactgagtatgataataacaaattcaagact
actgtagtaaatgataatggcctgagtccagtctgggcttctactcaggaaaaagtgaca
tttgagatttatgacccaaatcttgcatttctacgatttgttgtgtatgaggaggatatg
ttcagcgatcccaactttctggcacatgctacttatcccattaaaggaatcaaatcaggg
tttagatcagttcctcttaaaaatggttacagtgaagatattgaactggcctctcttcta
gttttctgtgagatgcgtcctgtgttggaaagtgaagaagagctttattcttcctgtcgc
cagcttcgaaggaggcaagaagagctgaataatgagcttttcttgtatgactctcatcag
aacttacgtaacgccaacagagatgctctcatgaatgaattcaatgtcaatgagaatcag
ttgcagttgtatcaggaaaagtgcaacaggagattaagggagaagagagtcagtaacagc
aaattctactcctag

KEGG   Sarcophilus harrisii (Tasmanian devil): 100923119
Entry
100923119         CDS       T02286                                 

Gene name
PLCG1
Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1 isoform X1
  KO
K01116  phosphatidylinositol phospholipase C, gamma-1 [EC:3.1.4.11]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr00562  Inositol phosphate metabolism
shr01100  Metabolic pathways
shr01521  EGFR tyrosine kinase inhibitor resistance
shr04012  ErbB signaling pathway
shr04014  Ras signaling pathway
shr04015  Rap1 signaling pathway
shr04020  Calcium signaling pathway
shr04062  Chemokine signaling pathway
shr04064  NF-kappa B signaling pathway
shr04066  HIF-1 signaling pathway
shr04070  Phosphatidylinositol signaling system
shr04072  Phospholipase D signaling pathway
shr04360  Axon guidance
shr04370  VEGF signaling pathway
shr04613  Neutrophil extracellular trap formation
shr04650  Natural killer cell mediated cytotoxicity
shr04658  Th1 and Th2 cell differentiation
shr04659  Th17 cell differentiation
shr04660  T cell receptor signaling pathway
shr04664  Fc epsilon RI signaling pathway
shr04666  Fc gamma R-mediated phagocytosis
shr04670  Leukocyte transendothelial migration
shr04722  Neurotrophin signaling pathway
shr04750  Inflammatory mediator regulation of TRP channels
shr04919  Thyroid hormone signaling pathway
shr04933  AGE-RAGE signaling pathway in diabetic complications
shr04935  Growth hormone synthesis, secretion and action
shr05012  Parkinson disease
shr05022  Pathways of neurodegeneration - multiple diseases
shr05135  Yersinia infection
shr05167  Kaposi sarcoma-associated herpesvirus infection
shr05170  Human immunodeficiency virus 1 infection
shr05171  Coronavirus disease - COVID-19
shr05200  Pathways in cancer
shr05205  Proteoglycans in cancer
shr05206  MicroRNAs in cancer
shr05214  Glioma
shr05223  Non-small cell lung cancer
shr05225  Hepatocellular carcinoma
shr05231  Choline metabolism in cancer
shr05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Module
shr_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:shr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100923119 (PLCG1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100923119 (PLCG1)
   04014 Ras signaling pathway
    100923119 (PLCG1)
   04015 Rap1 signaling pathway
    100923119 (PLCG1)
   04370 VEGF signaling pathway
    100923119 (PLCG1)
   04064 NF-kappa B signaling pathway
    100923119 (PLCG1)
   04066 HIF-1 signaling pathway
    100923119 (PLCG1)
   04020 Calcium signaling pathway
    100923119 (PLCG1)
   04070 Phosphatidylinositol signaling system
    100923119 (PLCG1)
   04072 Phospholipase D signaling pathway
    100923119 (PLCG1)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    100923119 (PLCG1)
   04650 Natural killer cell mediated cytotoxicity
    100923119 (PLCG1)
   04660 T cell receptor signaling pathway
    100923119 (PLCG1)
   04658 Th1 and Th2 cell differentiation
    100923119 (PLCG1)
   04659 Th17 cell differentiation
    100923119 (PLCG1)
   04664 Fc epsilon RI signaling pathway
    100923119 (PLCG1)
   04666 Fc gamma R-mediated phagocytosis
    100923119 (PLCG1)
   04670 Leukocyte transendothelial migration
    100923119 (PLCG1)
   04062 Chemokine signaling pathway
    100923119 (PLCG1)
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    100923119 (PLCG1)
   04919 Thyroid hormone signaling pathway
    100923119 (PLCG1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100923119 (PLCG1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100923119 (PLCG1)
  09158 Development and regeneration
   04360 Axon guidance
    100923119 (PLCG1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100923119 (PLCG1)
   05206 MicroRNAs in cancer
    100923119 (PLCG1)
   05205 Proteoglycans in cancer
    100923119 (PLCG1)
   05231 Choline metabolism in cancer
    100923119 (PLCG1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100923119 (PLCG1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100923119 (PLCG1)
   05214 Glioma
    100923119 (PLCG1)
   05223 Non-small cell lung cancer
    100923119 (PLCG1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100923119 (PLCG1)
   05171 Coronavirus disease - COVID-19
    100923119 (PLCG1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100923119 (PLCG1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100923119 (PLCG1)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    100923119 (PLCG1)
   05022 Pathways of neurodegeneration - multiple diseases
    100923119 (PLCG1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100923119 (PLCG1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100923119 (PLCG1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:shr04131]
    100923119 (PLCG1)
Enzymes [BR:shr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100923119 (PLCG1)
Membrane trafficking [BR:shr04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    100923119 (PLCG1)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    100923119 (PLCG1)
SSDB
Motif
Pfam: PI-PLC-X SH2 PI-PLC-Y SH3_1 C2 PH SH3_9 SH3_2 PH_12 GDPD
Other DBs
NCBI-GeneID: 100923119
NCBI-ProteinID: XP_031809864
Ensembl: ENSSHAG00000017720
LinkDB
Position
2
AA seq 1297 aa
MMAGVGAPFANGCGACAPSEAEALHLCRSLEVGTVMTLFYSKKSQRPERKTFQVKLETRQ
ITWSRGADKIEGAVDIREIKEIRPGKTSRDFDRYQEDPAFRPDQSHCFVILYGMEFRLKT
LSLQATSEDEVNMWIKGLNWLVTDTVQAATPLQIERWLRKQFYSVDRNREDRISAKDLKN
MLSQVNYRVPNMRFLRERLTDMEQRSGDITYGQFAQLYRSLMFSAQKSMDFPFLEAGTLR
GGDRPELCRVSLSEFQQFLLEYQGELWATDRLQVQEFMLSFLQDPLREIEEPYFFLDEFV
TFLFSKENNIWNSQLDSVCVDTMNNPLSQYWISSSHNTYLTGDQFSSESSLEAYARCLRM
GCRCIELDCWDGPDGMPVIYHGHTLTTKIKFSDVLHTIKEHAFVTSEYPVILSIEDHCSI
AQQRNMAQYFKKVFGDTLLTKPVDIAADGLPSPNQLKRKILIKHKKLAEGSAYEEVPTSV
MYSENDISNSIKNGILYLEDPINHEWYPHYFVLTSSKIYYSEETNSDQGNEDEEEPKEVS
SSAELHSSEKWFHGKLGAGRDGRHIAERLLTEYCIETGAPDGSFLVRESETFVGDYTLSF
WRNGKVQHCRIHSRQDAGSPKFFLTDNLVFDSLYDLITHYQQVPLRCNEFEMRLTEPVPQ
TNAHESKEWYHASLTRAQAEHMLMRVPRDGAFLVRKRSEPNSYAISFRAEGKIKHCRVQQ
EGQTVMLGNSEFDSLVDLISYYEKHPLYRKMKLRYPINEEALEKMGTAEPDYGALYEGRN
PGFYVEANPMPTFKCAVKALFDYKAQREDELTFTKSAIIQNVEKQEGGWWRGDYGGKKQL
WFPSNYVEEMANPATLEPERELCSLQQLDENSPLGDLLRGVLDVPACQIAIRPEGKNNRL
FVFSISMASIAHWSLDVAADSQEDLQDWVKKIREVAQTADARLTEGKMMERRKKIALELS
ELVIYCRPVPFDEDKIGTERACYRDMSSFPETKAEKYVNKTKGKKFLQYNRLQLSRIYPK
GQRLDSSNYDPLPMWICGSQLVALNFQTPDKPMQMNQALFMSSGRCGYVMQPSNMRDEAF
DPFDKCSLRGIEPCAVCIEVLGARHLPKNGRGIVCPFVEIEVAGADYDNMKHKTEFVVDN
GLNPVWPAKPFHFQISNPEFAFLRFVVYEEDMFSDQNFLAQATFLVKGLKTGYRAVPLKN
NYSEDLELASLLIKIDIFPAKQENGEISPFGSSSFRERGSESSGQLLHGRAREGSFEARY
QQPFEDFRISQEHLADHFDSRERRALRRTRINGDNRL
NT seq 3894 nt   +upstreamnt  +downstreamnt
atgatggcaggggtcggggcccccttcgccaatggctgcggggcctgcgctccgtcggag
gccgaggctcttcacctctgccggagtttggaagtgggcacagtcatgaccttgttctac
tccaagaaatcccagcgacctgagaggaaaaccttccaggtcaagttggagacccggcag
atcacgtggagtcgaggggcagataaaatcgagggagcggttgatattcgtgaaatcaag
gagatccggcctgggaaaacctctcgtgattttgaccgttaccaggaggacccggccttc
cggcccgaccagtcccattgctttgttatcctgtacggcatggaattccgcctgaaaacg
ctgagtctgcaagccacctcggaggacgaagtgaatatgtggatcaaaggcttgaactgg
ttggtgactgataccgtgcaggcggccacgcctctgcagatcgagaggtggctccggaag
cagttctactccgtggatcggaatcgggaagacaggatttctgccaaggatcttaagaac
atgctgtcccaggtcaactaccgagttcccaacatgcggttcctgagggaacggttgacg
gacatggagcagcggagtggggacatcacctatggccagtttgcgcagctctaccgcagc
ctcatgttcagtgcccagaaatcgatggactttcctttcctggaagccggcaccctgagg
ggcggggatcgacccgagctctgcagagtttccctgtcggagtttcagcagtttctcctg
gaataccagggggagctgtgggccactgacaggctgcaggtgcaggagttcatgctcagc
ttcctccaagacccgctccgggaaatcgaggagccttacttcttcctggacgagtttgtt
accttcctgttttccaaagagaataacatctggaactcccagctggattcggtgtgtgtg
gacaccatgaacaaccctctgtctcagtattggatctcttcatctcacaacacgtacctg
accggggaccagttctccagcgagtcctccttggaggcctatgcgcggtgcctccggatg
ggctgccgatgcatcgagttggactgctgggatggaccggacgggatgccagtcatttac
catggacacaccctcaccaccaagatcaagttctccgatgttctgcacaccatcaaggag
catgccttcgtgacctcggagtaccccgtgatcttgtccattgaggatcattgcagcatc
gctcagcagagaaacatggcccagtacttcaagaaggtatttggcgacacgcttctcacc
aagcccgtggacattgcggctgatggtctgccttcgcccaaccagctcaagagaaaaatc
cttatcaagcacaagaagctggctgagggcagtgcctacgaggaggtgcccacgtcggtg
atgtactcagagaatgacatcagcaattccatcaagaacggcatcctctatttggaagac
cccattaatcacgagtggtacccgcactactttgtactgaccagcagcaaaatctattac
tcagaggagaccaacagtgaccagggcaacgaggacgaggaggagccaaaggaggtgagc
agcagtgccgagctacactccagcgagaaatggttccatgggaagctaggggccggtcgg
gacgggcgacacatcgccgagcggctgcttaccgagtactgcattgagaccggagccccc
gacggttcctttctggttcgggagagtgagacctttgtcggggactacaccctgtccttc
tggcggaacgggaaggtgcagcactgccggatccactcccgtcaggacgccggcagcccc
aagttcttcctgacagacaacctggtgtttgactcgctctatgacctcatcacccactac
cagcaggtgccgctgcgatgcaacgagttcgagatgcgccttacggagcccgtgcctcag
actaacgcacacgagagcaaagagtggtaccacgccagtctgacccgagcccaggcggaa
catatgttgatgcgggttccccgggacggggccttcctcgtgcgaaagcggagcgagccc
aactcctacgccatctccttccgggcagaagggaagatcaaacattgccgggtccagcag
gaggggcagacggtgatgctggggaactcggagtttgacagccttgtagatctcatcagt
tactatgagaagcatccactgtatcgaaagatgaagctccggtaccccatcaatgaggag
gcattggagaagatgggcacagcggaacctgactatggagctctgtatgaaggacggaat
ccaggtttctatgtggaggcaaatcctatgccaacttttaagtgtgctgtcaaagccctc
tttgactacaaggcacagcgggaagatgagctgacctttacgaagagtgccatcatccag
aatgtggaaaagcaggagggaggctggtggaggggagactatggagggaagaagcagctc
tggtttccatccaactatgtggaagagatggccaatcctgccactttagagcctgagagg
gagctttgttctttacagcagttggatgagaatagccccctgggagatctgctccgtgga
gtcctggatgtgccggcctgccagatcgctatccgccccgaggggaagaacaaccgactc
tttgtgttctcgatcagcatggcgtccattgcccattggtccttggatgtggctgctgat
tcccaggaggacctacaggactgggtgaagaagatccgagaggttgcccagactgcggat
gcccggctcacagagggaaagatgatggaacgaaggaagaaaattgccttggagctgtct
gaacttgtcatttactgtcggcccgtccccttcgatgaggataagatcggcaccgagcgg
gcctgttaccgagacatgtcatccttccctgagaccaaggcagagaaatacgtgaataag
accaaaggcaagaagttcttgcagtataatcggcttcagctgtcacgcatttaccctaag
ggccaacggctggactcttccaactatgaccctttgcccatgtggatttgtggcagccaa
cttgtggccctcaacttccagactccagacaaacccatgcagatgaaccaggccttattc
atgtccagtgggcgttgtggatatgtgatgcagccaagcaacatgagagacgaagccttc
gacccctttgacaagtgtagcttgcgtgggatagagccatgtgcggtctgcattgaggtc
ctgggggcccggcacctccccaagaacggccggggcatcgtgtgtccttttgtggagatt
gaggtggccggggccgactacgacaacatgaagcacaagacggagtttgtggtggacaat
ggtctgaaccccgtttggccggcaaagcccttccacttccagattagtaaccccgagttt
gctttcctgcgctttgtggtatatgaagaagatatgttcagtgaccagaatttcttggct
caggccaccttcctggtgaaaggcctaaagacaggatacagagcggtgcctttgaagaat
aactacagtgaggacttggagttggcctctctgcttatcaaaatagatatatttcctgcc
aagcaggagaacggggagatcagtccctttggcagctcgtcgttccgagaacggggctcc
gaatcttctggccagctgctccacggacgggcccgggagggctcctttgaagcccgctac
cagcagcccttcgaggacttccgcatctcccaggagcacctagcagaccactttgacagc
cgggaacgaagggcacttcggagaactcgtatcaatggagacaaccgcctctag

DBGET integrated database retrieval system