KEGG   Sarcophilus harrisii (Tasmanian devil): 100919294Help
Entry
100919294         CDS       T02286                                 

Gene name
HK3
Definition
(RefSeq) LOW QUALITY PROTEIN: hexokinase-3
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr00010  Glycolysis / Gluconeogenesis
shr00051  Fructose and mannose metabolism
shr00052  Galactose metabolism
shr00500  Starch and sucrose metabolism
shr00520  Amino sugar and nucleotide sugar metabolism
shr00524  Neomycin, kanamycin and gentamicin biosynthesis
shr01100  Metabolic pathways
shr01200  Carbon metabolism
shr04066  HIF-1 signaling pathway
shr04910  Insulin signaling pathway
shr04930  Type II diabetes mellitus
shr04973  Carbohydrate digestion and absorption
shr05230  Central carbon metabolism in cancer
Module
shr_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
shr_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:shr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100919294 (HK3)
   00051 Fructose and mannose metabolism
    100919294 (HK3)
   00052 Galactose metabolism
    100919294 (HK3)
   00500 Starch and sucrose metabolism
    100919294 (HK3)
   00520 Amino sugar and nucleotide sugar metabolism
    100919294 (HK3)
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    100919294 (HK3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    100919294 (HK3)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100919294 (HK3)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100919294 (HK3)
 09160 Human Diseases
  09161 Cancers: Overview
   05230 Central carbon metabolism in cancer
    100919294 (HK3)
  09167 Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    100919294 (HK3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:shr04131]
    100919294 (HK3)
Enzymes [BR:shr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     100919294 (HK3)
Membrane trafficking [BR:shr04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    100919294 (HK3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 100919294
NCBI-ProteinID: XP_023362306
Ensembl: ENSSHAG00000010426
LinkDB All DBs
Position
1
AA seq 904 aa AA seqDB search
MNENTLESVQQCLNQFDVTEEQLQQIQAGILGDMERALGRQAGSSPSVQMLPTYVRSTPR
GTEQGDFLVLELGASGATLRVLWVTLTGISGPRKEPVSQEFTIPTEITLGTGQQLFDFAA
GCLVQFLDQLQVGSQPIQLGFNFSFPCHQTGLNQSTLISWTKGFRCSGVEGQDVVQLLRE
AIQRQGAYNIEVVAVVNDTVGAMMSCDPSPQACEVGLVVDTGTNACYMEEVRHVAELKED
RGRICVNVQWGSFGDGGALEPVQTPFDLQLDQESLHPGTQRFEKMVGGLYLGELVRLVLI
HLAGQGALFGGVTSPALLTHGSVHVQHVMEIEDPSHGRAPGQAMLQELGLTPSAQDCAQV
QRVCGAVSSRAARLCAAALTAVLARVRSNXGEIPTGRLCGYTGGRLYKQHPRFSALLQQT
VRLLAPDADVTFVPSEDGGGRGVAVVTAVASRLALQRRQLEETLAPFRLHSQQLKAVQAQ
MRESMVRGLRGESSSIRMLPTYVCAMPDGTERGDFLALDLGGTNFRVLWVKVGSRSEEGI
KIINRVFSLPESVTQGTGQQLFDHIVDCIVDFQKENNLSGQTLPLSFTFSFPCKQLGLDQ
GILLNWTKGFKASDCEGQDVVSLLRAAIRRRQGVELNVVAIVNDTVGTMMSCGYEDPHCE
VGLIVGTGTNACYMEELGNVCAVPGDRGRMCINMEWGAFGDDGLALQEFYTPFDLSVDQA
SINPGKQRYEKLISGMYLGEIVRQVLLHLTHLRVLFGGQEFPSLQTKDIIKTKFLSEIES
DLERWQVRAILEKLDLQADCEDALLVREVCQAVSRRAAQLCGAGVAAVVEKIRENRGLDR
LSVTVGVDGTLYKLHPHFSEQVKDAVRELAPQCCVRFLLSEDGSGKGAALVSAVACRLAG
AAGP
NT seq 2715 nt NT seq  +upstreamnt  +downstreamnt
atgaatgagaacaccctggagtcggtgcagcagtgcctgaaccagttcgatgtgacagag
gagcagttgcagcagatccaggctggcatcctgggggacatggagcgggccttgggcagg
caggcaggctcttccccctctgtccagatgctgcccacctatgttcgatccactcctcgt
ggcactgagcagggcgatttcctggtgttggagcttggggcctcaggagccactttgcgg
gtgctatgggtgacactcacaggcatctctggcccaagaaaagaaccagtaagccaggag
ttcaccatccccaccgaaatcacgcttggcactggacaacagctctttgactttgctgct
ggctgcttggtgcagttcctggaccagctgcaggtggggtcccaacccatccagttgggc
ttcaacttttccttcccctgtcaccaaacaggcctcaaccagagcacccttatttcctgg
accaagggcttcaggtgcagtggcgtggaaggccaggatgtggtgcaactgctgagagag
gccatccagaggcaaggggcctataacatcgaggtggttgctgtagtgaacgacacggtg
ggagccatgatgagctgtgacccttcgccccaggcgtgtgaagtcggactagttgtagac
acgggtaccaacgcctgctacatggaggaggtccggcacgtagcagaactgaaggaggac
cggggccgcatctgtgtgaacgtccagtggggctcctttggagatggtggggctctggag
cctgtgcagacgccctttgacctccagctggaccaggaatccttgcaccccgggacacaa
aggtttgagaagatggttgggggtctgtacctgggagagctcgttcgcttggtgctgata
cacctggctggccagggggccctttttgggggtgtcacctcccctgccctgctaacccat
gggtctgtgcacgtgcagcatgtgatggagatagaggacccttctcacggcagggctccg
ggccaagcaatgctgcaggagctgggcctgacccccagcgctcaggattgtgcgcaggtg
cagcgggtgtgtggagcggtgtcttcccgggctgcccgcctctgtgcagctgccctgaca
gccgtccttgcccgagtgaggagcaacnccggagagatccccactgggcgtctctgtggc
tacacagggggccgcctttacaagcagcacccccggttcagcgccctcctccagcagacc
gtgaggctcttggctccggacgccgatgtcacctttgtcccctcggaggacggtgggggc
cggggggtggctgtggtgaccgctgtggcctctcgcttggctctacagcggcggcagctg
gaggagaccctggcgcccttccggctccacagccagcagctgaaggcggtgcaggcccaa
atgcgggagtccatggtgcgggggctccggggagagagctcctccatccgcatgctgccc
acctatgtctgtgctatgcctgatggcacagaaagaggagactttctggctctggacctt
gggggcactaacttccgggtactctgggtgaaagtgggcagtaggagcgaggaaggaatc
aagattatcaaccgggtcttctcccttcctgagagtgtgacccaggggactgggcagcag
ctctttgaccacattgtagactgcatagtggacttccagaaggagaataatctgagtggg
cagactctgcccttgagtttcaccttctccttcccctgcaaacagcttggcctggatcag
ggcatcctcttgaactggactaagggctttaaagcatcagactgtgagggccaggatgtc
gtgtccctgcttcgagctgccatcagacgcagacagggagtggagctgaacgtggtggcc
attgtcaatgacacagtggggaccatgatgtcctgtggctatgaggacccccactgtgag
gtcggcctcattgtaggaactgggaccaacgcttgttacatggaggagctgggcaacgtg
tgcgccgtgcctggggacaggggccgcatgtgcatcaacatggagtggggagccttcggg
gatgacggcctagcgctccaagagttctatacgccctttgaccttagtgtggaccaagcc
tccatcaacccgggcaagcagaggtacgagaagctgataagcggcatgtatctgggtgag
atagtccgccaggtcctcttgcacctgacccacctccgggtcctgttcggcggccaggag
ttcccgagtcttcagactaaggacatcatcaagaccaagttcctgtctgagatcgaaagt
gacctggagaggtggcaggtgcgggccatcctagagaagctggatctgcaggccgactgc
gaggacgcgctgctggtgcgggaggtgtgccaggccgtgtcccggcgggcggcccagctc
tgcggggccggagtggcggccgtggtggagaagatccgggagaaccgcggcctggaccgg
ctgagcgtgacggtgggcgtggacggcacgctctacaagctgcacccccacttctcggag
caggtgaaggacgccgtgcgagagctggccccccagtgctgcgtcaggttcctgctgtcg
gaggacggctccgggaaaggggccgccctggtcagcgccgtggcctgccgcctggccgga
gccgctgggccctga

DBGET integrated database retrieval system