KEGG   Sarcophilus harrisii (Tasmanian devil): 100919671
Entry
100919671         CDS       T02286                                 

Definition
(RefSeq) cytochrome c 2
  KO
K08738  cytochrome c
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr01524  Platinum drug resistance
shr04115  p53 signaling pathway
shr04210  Apoptosis
shr04215  Apoptosis - multiple species
shr04932  Non-alcoholic fatty liver disease
shr05010  Alzheimer disease
shr05012  Parkinson disease
shr05014  Amyotrophic lateral sclerosis
shr05016  Huntington disease
shr05017  Spinocerebellar ataxia
shr05020  Prion disease
shr05022  Pathways of neurodegeneration - multiple diseases
shr05132  Salmonella infection
shr05134  Legionellosis
shr05145  Toxoplasmosis
shr05152  Tuberculosis
shr05160  Hepatitis C
shr05161  Hepatitis B
shr05162  Measles
shr05163  Human cytomegalovirus infection
shr05164  Influenza A
shr05167  Kaposi sarcoma-associated herpesvirus infection
shr05168  Herpes simplex virus 1 infection
shr05169  Epstein-Barr virus infection
shr05170  Human immunodeficiency virus 1 infection
shr05200  Pathways in cancer
shr05210  Colorectal cancer
shr05222  Small cell lung cancer
shr05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:shr00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100919671
   04215 Apoptosis - multiple species
    100919671
   04115 p53 signaling pathway
    100919671
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100919671
  09162 Cancer: specific types
   05210 Colorectal cancer
    100919671
   05222 Small cell lung cancer
    100919671
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100919671
   05012 Parkinson disease
    100919671
   05014 Amyotrophic lateral sclerosis
    100919671
   05016 Huntington disease
    100919671
   05017 Spinocerebellar ataxia
    100919671
   05020 Prion disease
    100919671
   05022 Pathways of neurodegeneration - multiple diseases
    100919671
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100919671
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100919671
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100919671
   05134 Legionellosis
    100919671
   05152 Tuberculosis
    100919671
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100919671
   05161 Hepatitis B
    100919671
   05160 Hepatitis C
    100919671
   05164 Influenza A
    100919671
   05162 Measles
    100919671
   05168 Herpes simplex virus 1 infection
    100919671
   05163 Human cytomegalovirus infection
    100919671
   05167 Kaposi sarcoma-associated herpesvirus infection
    100919671
   05169 Epstein-Barr virus infection
    100919671
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100919671
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100919671
SSDB
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 Docking
Other DBs
NCBI-GeneID: 100919671
NCBI-ProteinID: XP_003764050
Ensembl: ENSSHAG00000005285
UniProt: G3VSB9
LinkDB
Position
3
AA seq 104 aa
MEDVEEGRKIFVQKCAQCHTVEKNGKHKTGPNLWGLFGRRTGQASGYSYSEANKNKGIIW
NETNLVEYLENPKKFIPGTKMIFPGIRKRREREALVAYLKRVTK
NT seq 315 nt   +upstreamnt  +downstreamnt
atggaagatgttgaggaaggcaggaaaatctttgttcaaaaatgtgctcagtgtcacaca
gtggaaaaaaatggaaaacataagactggcccaaatctctggggtctgtttggccgaaga
acagggcaagcatctggatattcttattcagaagcaaacaaaaacaaaggtattatttgg
aatgaaactaatctagtggaatatttggagaatcctaaaaaatttatccctgggacaaaa
atgatttttcctggtatccgaaagaggagagagagagaagctcttgttgcatatttgaaa
agagtaacaaaatga

KEGG   Sarcophilus harrisii (Tasmanian devil): 111721251
Entry
111721251         CDS       T02286                                 

Definition
(RefSeq) cytochrome c
  KO
K08738  cytochrome c
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr01524  Platinum drug resistance
shr04115  p53 signaling pathway
shr04210  Apoptosis
shr04215  Apoptosis - multiple species
shr04932  Non-alcoholic fatty liver disease
shr05010  Alzheimer disease
shr05012  Parkinson disease
shr05014  Amyotrophic lateral sclerosis
shr05016  Huntington disease
shr05017  Spinocerebellar ataxia
shr05020  Prion disease
shr05022  Pathways of neurodegeneration - multiple diseases
shr05132  Salmonella infection
shr05134  Legionellosis
shr05145  Toxoplasmosis
shr05152  Tuberculosis
shr05160  Hepatitis C
shr05161  Hepatitis B
shr05162  Measles
shr05163  Human cytomegalovirus infection
shr05164  Influenza A
shr05167  Kaposi sarcoma-associated herpesvirus infection
shr05168  Herpes simplex virus 1 infection
shr05169  Epstein-Barr virus infection
shr05170  Human immunodeficiency virus 1 infection
shr05200  Pathways in cancer
shr05210  Colorectal cancer
shr05222  Small cell lung cancer
shr05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:shr00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    111721251
   04215 Apoptosis - multiple species
    111721251
   04115 p53 signaling pathway
    111721251
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111721251
  09162 Cancer: specific types
   05210 Colorectal cancer
    111721251
   05222 Small cell lung cancer
    111721251
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    111721251
   05012 Parkinson disease
    111721251
   05014 Amyotrophic lateral sclerosis
    111721251
   05016 Huntington disease
    111721251
   05017 Spinocerebellar ataxia
    111721251
   05020 Prion disease
    111721251
   05022 Pathways of neurodegeneration - multiple diseases
    111721251
  09166 Cardiovascular disease
   05416 Viral myocarditis
    111721251
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    111721251
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111721251
   05134 Legionellosis
    111721251
   05152 Tuberculosis
    111721251
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    111721251
   05161 Hepatitis B
    111721251
   05160 Hepatitis C
    111721251
   05164 Influenza A
    111721251
   05162 Measles
    111721251
   05168 Herpes simplex virus 1 infection
    111721251
   05163 Human cytomegalovirus infection
    111721251
   05167 Kaposi sarcoma-associated herpesvirus infection
    111721251
   05169 Epstein-Barr virus infection
    111721251
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    111721251
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    111721251
SSDB
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 CCP_MauG
Other DBs
NCBI-GeneID: 111721251
NCBI-ProteinID: XP_031796426
LinkDB
Position
5
AA seq 105 aa
MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGFTYTDANKNKGIIW
GDDTLMEYLENPKKYIPGTKMIFAGIKKKGEREDLIAYLKKSTNE
NT seq 318 nt   +upstreamnt  +downstreamnt
atgggggacgtggagaagggcaagaagatcttcgtgcagaagtgcgcccagtgccacacg
gtggagaagggcggcaagcacaagaccgggcccaacctgcacgggctcttcggccgcaag
accggccaggcccccggcttcacctacacagacgccaacaagaacaaaggcatcatctgg
ggagacgacaccctgatggagtacctggaaaaccccaagaagtacatcccgggcacaaag
atgatcttcgccggcatcaagaagaagggggagagggaagacttgatagcctacctcaag
aagagcaccaatgagtaa

DBGET integrated database retrieval system