KEGG   Sarcophilus harrisii (Tasmanian devil): 100920746Help
Entry
100920746         CDS       T02286                                 

Gene name
GAD2
Definition
(RefSeq) glutamate decarboxylase 2
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr00250  Alanine, aspartate and glutamate metabolism
shr00410  beta-Alanine metabolism
shr00430  Taurine and hypotaurine metabolism
shr00650  Butanoate metabolism
shr01100  Metabolic pathways
shr04727  GABAergic synapse
shr04940  Type I diabetes mellitus
Module
shr_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:shr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    100920746 (GAD2)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    100920746 (GAD2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100920746 (GAD2)
   00430 Taurine and hypotaurine metabolism
    100920746 (GAD2)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    100920746 (GAD2)
 09160 Human Diseases
  09166 Endocrine and metabolic diseases
   04940 Type I diabetes mellitus
    100920746 (GAD2)
Enzymes [BR:shr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     100920746 (GAD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Beta_elim_lyase
Motif
Other DBs
NCBI-GeneID: 100920746
NCBI-ProteinID: XP_003771904
Ensembl: ENSSHAG00000013305
UniProt: G3WJK8
LinkDB All DBs
Position
5
AA seq 587 aa AA seqDB search
MASTGSGFWSFGSEDGSGDPENPSTARAWCQVAQKFTGGIGNKLCALLYGDAEKPMETSG
SEKETQGSADKKTVCTCNQKPCSCPKTDLNYACLHSTDLLPACNGEVATLSFLQDVMDIL
LQYVVKSFDRSTKVIDFHYPNELLQEHNWELADQPQTLEEILSNCRTTLKYAIKTGHPRY
FNQLSTGLDMVGLAADWLTSTANTNMFTYEIAPVFVLLEYVTLRKMREIVGWPGGSGDGI
FSPGGAISNMYAMLIARFKMFPEVKEKGMAAIPRLVAFTSEHSHFSVKKGAAALGIGTDS
VILIKCDERGKMIPSDLERRIVEAKQKGFVPFLVSATAGTTVYGAFDPLLAIADICKKYK
IWMHVDAAWGGGLLMSRKHKWKLNGVERANSVTWNPHKMMGVPLQCSALLVREEGLMQSC
NQMHASYLFQQDKHYDLSYDTGDKALQCGRHVDVFKLWLMWRAKGTIGFEAQIDKCLELA
EYLYNLIKNREGYEMVFDGKPQHTNVCFWYIPPSLRHLEDNEERMSRLLKVAPVIKARMM
EYGTTMVSYQPLGDKVNFFRMVISNPAATHQDIDFLIEEIERLGQDL
NT seq 1764 nt NT seq  +upstreamnt  +downstreamnt
atggcatctacgggctctggcttttggtccttcgggtccgaagatggctccggagacccg
gagaaccccagcacagctagagcctggtgccaggttgcccagaagttcaccggaggcatt
ggaaacaaactctgtgccttgctgtatggagacgctgaaaagccaatggaaacttccggc
agcgagaaggagactcagggatcagccgataaaaagactgtctgtacttgcaatcaaaag
ccctgtagctgccccaaaacggatctcaattacgcgtgtttacactcaacagatctgttg
ccagcatgtaacggagaagtggccactttgtcttttctccaagatgtaatggacattttg
cttcagtatgtggtgaagagttttgatagatcaacaaaggtgattgatttccattaccca
aacgagcttcttcaagaacataattgggaattggcagatcagccacagaccctggaggaa
attttgtccaactgcagaacaactctaaaatatgcaatcaaaacaggtcatcctagatat
ttcaatcaactttctactggattggatatggttggattagcagcagactggctaacttca
acagcaaatactaatatgttcacctatgaaattgctccagtgtttgtacttttggaatat
gtcacattaaggaaaatgagagaaattgtcggctggccggggggcagtggtgatgggatc
ttttcacctggtggtgccatatctaacatgtatgctatgttgattgcacgtttcaagatg
tttcccgaagtcaaagagaaaggaatggcagctattcccagactggttgccttcacatct
gagcatagtcacttttcagtaaagaagggagctgcagccttggggattggaacagacagt
gtgattctgatcaaatgtgatgaaagaggaaaaatgattccatctgatctggagagaaga
attgttgaagctaaacaaaaaggatttgttcctttccttgtgagtgccactgccgggacc
acagtgtatggcgcatttgatcctctgctagctattgctgacatctgcaagaaatataag
atctggatgcatgtggacgcagcttggggtggcggactcctgatgtcccggaaacataaa
tggaagcttaatggcgtggaaagggccaactctgtgacatggaaccctcacaagatgatg
ggcgtccccttgcagtgctcagctctgctggtgagagaagaggggttgatgcagagctgc
aaccagatgcatgcttcttacctctttcaacaagataaacactacgatttgtcttatgat
accggagacaaggctttacagtgtgggcgccatgttgatgttttcaaattatggctaatg
tggagggcaaaggggaccatcggatttgaagcacagattgacaagtgtttggagcttgca
gagtatttatacaaccttataaaaaacagagaaggatatgaaatggtgtttgatggaaag
cctcagcacacaaatgtctgcttctggtatatccccccaagtttgcggcacttggaagac
aatgaagaaagaatgagtcgcctcttaaaggtcgcccctgtgattaaagccaggatgatg
gagtatggaaccaccatggtcagctaccaacccttgggagataaagtcaatttctttcgc
atggtcatctcaaatccagcagcaactcatcaagacatcgatttcctgattgaggaaata
gaacgtcttggacaggatttataa

DBGET integrated database retrieval system