KEGG   Sarcophilus harrisii (Tasmanian devil): 100921282
Entry
100921282         CDS       T02286                                 

Gene name
CTNNA3
Definition
(RefSeq) catenin alpha-3 isoform X1
  KO
K05691  catenin alpha
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr04390  Hippo signaling pathway
shr04520  Adherens junction
shr04670  Leukocyte transendothelial migration
shr05100  Bacterial invasion of epithelial cells
shr05200  Pathways in cancer
shr05213  Endometrial cancer
shr05226  Gastric cancer
shr05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:shr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    100921282 (CTNNA3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    100921282 (CTNNA3)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    100921282 (CTNNA3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100921282 (CTNNA3)
  09162 Cancer: specific types
   05226 Gastric cancer
    100921282 (CTNNA3)
   05213 Endometrial cancer
    100921282 (CTNNA3)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    100921282 (CTNNA3)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100921282 (CTNNA3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:shr04812]
    100921282 (CTNNA3)
Cytoskeleton proteins [BR:shr04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     100921282 (CTNNA3)
SSDB
Motif
Pfam: Vinculin
Other DBs
NCBI-GeneID: 100921282
NCBI-ProteinID: XP_031805334
LinkDB
Position
2
AA seq 895 aa
MSAEMPIQLKMNPQDLQIQTHTVEKLLEPLIIQVTTLVNCPQNLSNRKKGRSKRARVLLA
SVEEATWNLLDKGEKIAREATVLKEELTAALQEVRTESEALKVSAETFTDDPCYLPKREA
VVQVARALLAAVTRLLILADMIDVMYLLQHVSAFQKTFESLKNASNKSDLQKSYQKLGKE
LENLDYLAHKRQQDLKSPVQRDEIAGARASLKENSPLLHSICSACLEHDDVASLQASKDT
VCDEIQNALDVISNASQGIQSPKAELEPQSATLGSALDELENLVILDPLTVSDEKIRPSL
EKRLEAIISGAALLADSSCTRDFHRERIITECNSIRQALQDLLSEYMDNAGKKERSNALN
VAIDNMCKKTRDLRRQLRKAIIDHVSDSFLDTTVPLLVLIEAAKNGREKEMKEYAAIFRE
HTNRLVEVANLACSLSANEDGIKIVKTAASHMETLCPQVINAALALTARPKSQAVKSNMD
MYKRLWENHIHVLTEAVDDITSIDDFLAVSESHILEDVNKCIIALRDQDIDNLDRAAGAI
KGRAARVAHIVMGEMDSYEPGAYTEGVLRKVGYLTNNAIPEFITQVNIALEALNMNAMHQ
FDDSQFVDASKKVYDSIHDIRCAVMMIRTPEELEDISDLEEDHDVRSHTSVQTEGKTDRA
KMTQLPEAEKEKIAEQVADFKKVKSKLDAEIEIWDDTSNDIIVLAKKMCMIMMEMTDFTR
GRGPLKHTTDVIYAAKMISESGSRMDILARQIAKQCPDPSCKQDLLAYLEQIKFYSHQLK
ICSQVKAEIQNLGGELIMSALDSVTSLIQAAKNLMNAVVHTVKMSYIASTKIIRIQSSTG
PRHPVVMWRMKAPAKKPLIKREKPEEVFAAVRRGSAKKQIHPVQVMSEFRGRQVN
NT seq 2688 nt   +upstreamnt  +downstreamnt
atgtcagctgagatgccgatccaactgaaaatgaatccccaggacctccagatccagaca
catacagtggagaagctgttagaacctctcataatccaggtcacgacactggtgaattgt
ccccagaatctttccaataggaaaaaaggacgttcaaaaagggcccgggttcttcttgct
tccgttgaagaagccacgtggaatctgctcgataagggggagaagattgccagggaggcc
accgtcctaaaggaagagcttacagcagccctgcaggaagtgcgcacagaaagtgaagct
ctgaaggtatcggctgaaacatttacagatgatccctgttatctgcctaagagggaggct
gtggttcaggttgcccgtgccttgttagctgctgtcaccaggctgctcatcttggctgac
atgattgatgtcatgtacctcctgcaacacgtgtctgcttttcagaagacatttgagtcc
ctcaagaatgcatccaacaaatctgatctgcagaagagctaccagaaacttggcaaggag
ctagaaaatctggattatttggctcacaaacgccagcaggacttaaaatctccagtccag
cgagatgagattgcaggggcccgggcttctctcaaggaaaactctcctcttctgcattca
atttgttctgcgtgcctggagcatgatgatgtggcctctctccaagccagcaaggacacg
gtctgtgatgagatccagaatgcccttgatgtgatttctaatgcatctcaagggatccag
agtccaaaagctgagctcgagcctcagtcagccacactgggaagtgcattggatgaactt
gagaatttagtaatcttggatccactgacagtgagtgatgagaaaatccgtccttcactt
gaaaagcgcttagaggccatcatcagtggggcagctttgttggctgattcttcctgcaca
cgggacttccaccgggaacgtatcatcactgagtgtaactctatccgacaagctctccag
gacttgctctcagaatacatggacaatgctgggaagaaggaaaggagcaatgccctgaat
gtcgcaatagataacatgtgcaaaaagactcgagacctgcgtagacagctccgtaaggcc
attattgaccatgtgtcagactctttcttggacacaacagtcccccttctggttctcatt
gaagcagccaagaatgggagagaaaaggaaatgaaagagtatgctgctatatttcgtgag
cacaccaaccggcttgtcgaggtggctaatcttgcttgttccctgtctgcaaatgaagac
ggaataaaaattgttaagacagcagccagtcacatggagacattgtgcccgcaggttatc
aacgcagctctagcactcactgcccgacccaaaagccaggcagtaaaatccaatatggac
atgtataagcgcctgtgggaaaaccacatccacgtcctcactgaagcagtagatgacatc
acaagcattgatgacttccttgctgtctctgagagccacatcctggaggatgtcaacaag
tgtatcattgctctaagagaccaagatattgacaatttagaccgtgcagctggggcaatc
aaaggacgggccgcaagagttgctcacatcgttatgggagaaatggacagttatgagcct
ggggcttacactgaaggagtgctgaggaaagttggctaccttaccaacaatgcaatccca
gagttcatcacccaagtcaacattgccttggaagccctcaacatgaatgccatgcatcaa
tttgatgatagccagtttgtggatgcctccaaaaaggtctatgactcaatccatgatatc
cgctgtgctgtcatgatgatcaggactcctgaggagctagaagatatttcagatctggaa
gaagatcatgatgttcgcagtcacacgagtgttcaaacagaagggaagacagacagggct
aaaatgactcaactacctgaggctgaaaaggaaaagattgcagagcaagtagctgatttc
aaaaaagtcaagagcaaactggatgctgaaattgagatatgggatgataccagcaatgac
atcatcgtcctggccaagaagatgtgcatgattatgatggagatgacagacttcaccagg
ggcagaggcccactgaaacacacaactgatgtgatttatgcagctaaaatgatatccgaa
tcaggctcaaggatggatatccttgctcggcagatcgccaaacaatgccctgacccatct
tgcaagcaagatttattggcttatctggaacagataaaattctattctcaccagctcaaa
atatgcagtcaagtgaaagctgaaatccagaatttgggaggagagctaatcatgtctgct
ttggatagtgtcacctctctaatccaagctgccaagaacttgatgaatgctgtagtccac
accgtgaaaatgtcctacattgcctccaccaagatcatcaggatccaaagttctacaggg
ccccgacatcctgtagtcatgtggagaatgaaagctcctgcaaaaaagccgctgattaaa
cgagagaagccagaggaggtctttgcagcagtgagaagaggttctgctaaaaagcaaatc
caccctgtccaagtcatgagtgaattcagaggaagacaagtcaactag

KEGG   Sarcophilus harrisii (Tasmanian devil): 100925228
Entry
100925228         CDS       T02286                                 

Gene name
CTNNA2
Definition
(RefSeq) catenin alpha-2 isoform X1
  KO
K05691  catenin alpha
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr04390  Hippo signaling pathway
shr04520  Adherens junction
shr04670  Leukocyte transendothelial migration
shr05100  Bacterial invasion of epithelial cells
shr05200  Pathways in cancer
shr05213  Endometrial cancer
shr05226  Gastric cancer
shr05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:shr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    100925228 (CTNNA2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    100925228 (CTNNA2)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    100925228 (CTNNA2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100925228 (CTNNA2)
  09162 Cancer: specific types
   05226 Gastric cancer
    100925228 (CTNNA2)
   05213 Endometrial cancer
    100925228 (CTNNA2)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    100925228 (CTNNA2)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100925228 (CTNNA2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:shr04812]
    100925228 (CTNNA2)
Cytoskeleton proteins [BR:shr04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     100925228 (CTNNA2)
SSDB
Motif
Pfam: Vinculin
Other DBs
NCBI-GeneID: 100925228
NCBI-ProteinID: XP_031812976
LinkDB
Position
2
AA seq 953 aa
MTSATSPIILKWDPKSLEIRTLTVERLLEPLVTQVTTLVNTSNKGPSGKKKGRSKKAHVL
AASVEQATQNFLEKGEQIAKESQDLKEELVTAVEDVRKQGETMRIASSEFADDPCSSVKR
GTMVRAARALLSAVTRLLILADMADVMRLLSHLKIVEEALEAVKNATNEQDLANRFKEFG
KEMVKLNYVAARRQQELKDPHCRDEMAAARGALKKNATMLYTASQAFLRHPDVAATRANR
DYVFKQVQEAIAGISNAAQATSPTDENKGHTGIGELAAALNEFDNKIILDPMTFSEARFR
PSLEERLESIISGAALMADSSCTRDDRRERIVAECNAVRQALQDLLSEYMNNTGRKEKGD
PLNIAIDKMTKKTRDLRRQLRKAVMDHISDSFLETNVPLLVLIEAAKSGNEKEVKEYAQV
FREHANKLVEVANLACSISNNEEGVKLVRMAATQIDSLCPQVINAALTLAARPQSKVAQD
NMDVFKDQWEKQVRVLTEAVDDITSVDDFLSVSENHILEDVNKCVIALQEGDVDTLDRTA
GAIRGRAARVIHIINAEMENYEAGVYTEKVLEATKLLSETVMPRFAEQVEVAIEALSANV
PQPFEENEFIDASRLVYDGVRDIRKAVLMIRTPEELEDDSDFEQEDYDVRSRTSVQTEDD
QLIAGQSARAIMAQLPQEEKAKIAEQVEIFHQEKSKLDAEVAKWDDSGNDIIVLAKQMCM
IMMEMTDFTRGKGPLKNTSDVINAAKKIAEAGSRMDKLARAVADQCPDSACKQDLLAYLQ
RIALYCHQLNICSKVKAEVQNLGGELIVSGTGVQNTFTTFYEVDCDVIDGGRASQLSTHL
PTCAEGALLGSGSSDSSMLDSATSLIQAAKNLMNAVVLTVKASYVASTKYQKVYGTAAVN
SPVVSWKMKAPEKKPLVKREKPEEYQTRVRRGSQKKHISPVQALSEFKAMDSF
NT seq 2862 nt   +upstreamnt  +downstreamnt
atgacttcggccacttcacctatcattttgaaatgggaccccaaaagtttggaaataagg
acactgacagtggagagactactggaacctcttgttacacaggtgacaaccttggtcaat
acaagcaacaaggggccatcagggaagaagaaaggtcgatctaagaaagctcatgtgtta
gcagcttctgtggagcaggccactcaaaatttcttggaaaaaggtgaacagattgccaaa
gaaagtcaggatctcaaagaagaactggtcactgctgtagaggatgtacgcaaacaaggt
gaaaccatgagaattgcttcttcagaatttgctgatgacccatgttcatcggtgaaacgc
ggcaccatggtgcgagctgcccgtgctttgctctcagccgttactcgcttgctcatttta
gctgacatggccgatgtcatgagacttttatctcacttgaaaatcgttgaggaagctctg
gaagctgtgaaaaatgctacaaatgagcaagaccttgcaaatcgctttaaggagtttgga
aaagagatggtgaaattgaactatgtagctgccagaagacagcaggaactgaaggaccct
cactgtagggatgaaatggcagctgcccgaggggctctgaagaagaacgccactatgctg
tacacagcatcccaagcatttctccgtcacccagatgtggctgccacaagggccaaccga
gactacgtcttcaaacaagtccaggaagctattgcgggcatttcaaatgcagctcaggct
acttcacccactgatgaaaacaaagggcacactggcattggggagttggctgctgctctc
aatgagtttgataacaagatcattttagaccccatgacattcagtgaggctcgattcaga
ccatctctagaagaaaggctggagagcattatcagtggtgcagcgctgatggcggattcc
tcctgtactcgtgatgaccgtcgggagagaattgtagctgagtgtaatgcagtccgacag
gccctccaggatcttctcagcgaatacatgaataatactggaaggaaagaaaaaggagat
cctctaaacattgctattgataagatgaccaagaaaacaagagatctaaggagacagctt
cgaaaggcagtgatggatcatatatcagattcattcctggaaaccaatgtccccttgctg
gttctgattgaagctgccaagagtgggaatgagaaggaagtcaaggaatatgctcaagtt
ttccgtgaacacgccaataagctggtggaggttgctaacttggcctgctccatttccaac
aatgaggaaggtgtgaagttagtccggatggcagcaacccagattgatagtctgtgtcca
caggtcatcaatgctgccctcaccttagctgccagacctcagagcaaagttgctcaagat
aatatggatgtcttcaaagatcagtgggagaagcaagttcgagtcctgacggaggctgtg
gatgatatcacatcagtggatgacttcttatctgtctcagaaaatcacattctggaggat
gtgaataagtgtgtgattgctctccaagaaggggatgtcgatactttggaccggacagca
ggtgcgatccgtggccgggcagcccgcgtcattcatatcatcaatgcagagatggagaac
tatgaagctggcgtttataccgaaaaggtgctagaagctacaaaattgttgtccgagaca
gttatgcctcgttttgcggaacaagtggaggtggccattgaagctttgagtgccaatgtg
cctcagccctttgaggagaatgagttcattgatgcttctcgtctggtgtatgatggagtt
cgagacatcaggaaagctgttctcatgattcggactccagaagaattagaagatgattcg
gactttgaacaggaagactatgatgtacgtagccggaccagtgtccagactgaggatgac
cagctcattgctggacagagtgcacgggccatcatggctcagctaccccaagaggaaaag
gcaaaaatagcagaacaggtggaaatcttccatcaggagaagagcaagctggatgccgag
gtggctaaatgggacgacagtggcaatgatatcattgtcctggccaagcagatgtgtatg
atcatgatggaaatgacagacttcacgagagggaagggcccattgaaaaacacttctgat
gttattaatgcagccaagaaaattgctgaagccggttcacgaatggacaaattggcccga
gctgtggctgaccagtgtcctgattctgcgtgcaaacaggatttattagcctaccttcaa
cgaattgccttgtattgccaccagcttaatatctgcagcaaggtcaaggcagaagtacag
aacttgggcggagagctgattgtatcagggacaggagttcagaacactttcactaccttt
tatgaggtagattgtgatgtcatagatgggggcagggctagtcaactttctacccatcta
ccaacctgtgctgagggagctctgctcgggagtggaagcagtgattcttccatgctggat
agtgccacatccctcatccaggcggccaagaacttgatgaatgctgtggttctcactgtg
aaagcctcctacgtggcctccaccaaataccagaaggtctacgggacagctgctgtgaac
tcccctgtagtgtcatggaagatgaaagctcctgagaaaaagcccttagtgaagcgagaa
aaaccagaagaataccagacaagagttagacgaggctctcagaagaaacacatttctcct
gtacaggcgttaagtgaatttaaagcaatggattccttttag

KEGG   Sarcophilus harrisii (Tasmanian devil): 100930828
Entry
100930828         CDS       T02286                                 

Definition
(RefSeq) catenin alpha-1
  KO
K05691  catenin alpha
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr04390  Hippo signaling pathway
shr04520  Adherens junction
shr04670  Leukocyte transendothelial migration
shr05100  Bacterial invasion of epithelial cells
shr05200  Pathways in cancer
shr05213  Endometrial cancer
shr05226  Gastric cancer
shr05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:shr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    100930828
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    100930828
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    100930828
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100930828
  09162 Cancer: specific types
   05226 Gastric cancer
    100930828
   05213 Endometrial cancer
    100930828
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    100930828
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100930828
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:shr04812]
    100930828
Cytoskeleton proteins [BR:shr04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     100930828
SSDB
Motif
Pfam: Vinculin HTH_Tnp_Mu_1 I_LWEQ
Other DBs
NCBI-GeneID: 100930828
NCBI-ProteinID: XP_031809216
LinkDB
Position
2
AA seq 536 aa
MTKKTRDLRRQLRKAVMDHVSDSFLETNVPLLVLIEAAKNGNEKEVKEYAQVFREHANKL
IEVANLACSISNNEEGVKLVRMSASQLEALCPQVINAALALAAKPQSKLAQENMDLFKEQ
WEKQVRVLTDAVDDITSIDDFLAVSENHILEDVNKCVIALQEKDVDGLDRTAGAIRGRAA
RVIHVVTSEMDNYEPGVYTEKVLEATRLLSNTVMPRFTEQVEAAVEALSSDPAQPMDENE
FIDASRLVYDGIRDIRKAVLMIRTPEELDDSDFETEDFDVRSRTSIQTEDDQLIAGQSAR
AIMAQLPQEQKAKIAEQVASFQEEKSKLDAEVSKWDDSGNDIIVLAKQMCMIMMEMTDFT
RGKGPLKNTSDVISAAKKIAEAGSRMDKLGRTIADHCPDSACKQDLLAYLQRIALYCHQL
NICSKVKAEVQNLGGELVVSGVDSAMSLIQAAKNLMNAVVQTVKASYVASTKYQKSQGMA
SLNLPAVSWKMKAPEKKPLVKREKQDETQTKIKRASQKKHVNPVQALSEFKAMDSI
NT seq 1611 nt   +upstreamnt  +downstreamnt
atgacaaaaaagaccagggatttacgaagacagctccgcaaagctgtcatggaccatgtt
tcagattcattcttggaaactaatgtgccacttttggtattgattgaggctgcaaagaat
ggaaatgagaaagaagttaaagagtacgctcaagttttccgtgaacatgcaaataaactt
attgaggtggctaacttagcctgttctatttcaaacaatgaagaaggtgtgaagctggtt
cgaatgtctgcaagccaactggaagccctctgtcctcaggttattaatgctgcattggct
ttggctgcaaaaccacaaagtaaactggcccaggagaatatggatctttttaaagaacag
tgggaaaagcaagtccgggttctaacagacgctgttgatgacattacttccattgatgat
ttcctggctgtttcagagaatcacattttagaagatgtaaacaagtgtgtaattgctctc
caagaaaaagatgttgatggtctagaccgcactgctggtgccatccggggtcgagcagcc
agagttattcatgttgtcacttcagagatggataactatgaacctggagtctacactgaa
aaggttcttgaggctaccagattgctttctaatacagttatgccacgttttactgagcaa
gtagaggctgctgtggaagctctcagttctgatcccgcccaaccaatggatgaaaatgaa
tttattgatgcctcacgattggtctatgatggcattagagacatcagaaaagctgtgttg
atgataaggactcctgaagagttggatgattctgactttgagacagaagactttgatgtt
agaagtagaacaagcatccaaactgaagatgatcagctcattgctggccaaagtgcacgg
gctatcatggcccagcttccccaagaacagaaggctaaaattgctgagcaggtggccagc
tttcaagaagaaaagagcaaactggatgctgaagtatccaaatgggatgatagtggcaat
gacattattgtcctggccaaacagatgtgcatgatcatgatggagatgacagatttcacc
agaggtaaaggaccgcttaaaaatacatcagatgtaattagtgcagctaagaaaattgct
gaggcaggatcaaggatggataagttgggaagaaccattgcagaccattgcccggattcg
gcctgcaaacaggacctgctggcctacctgcagcgtatcgccctgtactgccaccagctc
aacatctgcagcaaagtcaaagccgaggtgcagaacctgggcggggagctggtcgtctct
ggggtggacagtgcaatgtccctgatccaagcagccaagaacctgatgaatgctgtggta
cagacggtgaaggcttcctacgtggcctccaccaagtaccagaagtcccaggggatggct
tctcttaaccttcccgctgtgtcctggaagatgaaggccccagaaaagaagcccttggtg
aagagagaaaagcaggatgaaacccagacgaaaatcaagcgggcgtctcagaagaagcat
gtgaatcctgtgcaagccctcagtgagttcaaggccatggacagtatctag

DBGET integrated database retrieval system