KEGG   Sarcophilus harrisii (Tasmanian devil): 100921292Help
Entry
100921292         CDS       T02286                                 

Gene name
CDC23
Definition
(RefSeq) cell division cycle protein 23 homolog
  KO
K03355  anaphase-promoting complex subunit 8
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr04110  Cell cycle
shr04114  Oocyte meiosis
shr04120  Ubiquitin mediated proteolysis
shr04914  Progesterone-mediated oocyte maturation
shr05166  HTLV-I infection
Module
shr_M00389  APC/C complex
Brite
KEGG Orthology (KO) [BR:shr00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100921292 (CDC23)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100921292 (CDC23)
   04114 Oocyte meiosis
    100921292 (CDC23)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100921292 (CDC23)
 09160 Human Diseases
  09167 Infectious diseases
   05166 HTLV-I infection
    100921292 (CDC23)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:shr04121]
    100921292 (CDC23)
   03036 Chromosome and associated proteins [BR:shr03036]
    100921292 (CDC23)
Ubiquitin system [BR:shr04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     100921292 (CDC23)
Chromosome and associated proteins [BR:shr03036]
 Eukaryotic Type
  Sister chromatid separation proteins
   APC/C complex
    100921292 (CDC23)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ANAPC8 TPR_1 TPR_2 TPR_8 TPR_14 TPR_19 TPR_11 TPR_16 TPR_7 ANAPC3 TPR_17 TPR_12 DUF772 TPR_9 TPR_15
Motif
Other DBs
NCBI-GeneID: 100921292
NCBI-ProteinID: XP_003756631
Ensembl: ENSSHAG00000010848
UniProt: G3WB71
LinkDB All DBs
Position
1
AA seq 595 aa AA seqDB search
MAALVSVVAASMPSVVAPGTCSDFSDLREIKKQLLRIAGLSRERGLQHSGKWASELAFSL
APLPLSELPPPPPLTEEDAQDLDAYTLAKAYFDVKEYDRAAHFLRGCKSQKAYFLYMYSR
YLSGEKKKDDETVDSLGPLEKGQVKNEALRELRVELSKKHQARELDGFGLYLYGVVLRKL
DLVKEAIDVFVEATHILPLHWGAWLELCNLITDKEMLKFLSLPDTWMKEFFLAHIYTELQ
LIEEALQKYQSLIDVGFSKSTYIISQIAVAYHNIRDIDKALSIFNELRKQDPYRIENMDT
FSNLLYVRSMKPELSYLAHNLCEIDKYRVETCCVIGNYYSLRSQHEKAALYFQRALKLNP
RYLGAWTLMGHEYMEMKNTSAAIQAYRHAIEVNKRDYRAWYGLGQTYEILKMPFYCLYYY
RRAHQLRPNDSRMLVALGECYEKLNQLVEAKKCYWRAYAVGDVEKMALVKLAKLHEQLTE
SEQAAQCYIKYIQDIYSCGEIVEHLEVSTAFRYLAQYYFKCKLWDEASACAQKCCSFNDT
REEGKALLRQILQLRNQGETSTTEISAPFFLPASLSANNTPTRRVSPLNLSSVTP
NT seq 1788 nt NT seq  +upstreamnt  +downstreamnt
atggctgctttggtctccgttgtggcggcatctatgccttctgtggtagctccgggaact
tgcagcgacttctcagatctgagggaaatcaagaagcagctcctccggatcgcggggttg
agccgggagcgaggtttgcaacatagtgggaaatgggcctcggaactggccttctccctg
gcgccgttgcccttgtctgagctgccgccgcctccacccctcactgaggaagatgcacaa
gatttggatgcttacactctagccaaggcctactttgatgtaaaagaatatgatcgggca
gctcacttccttcgtggttgcaagagccagaaagcctatttcctgtatatgtattcaaga
tacttgtctggagaaaagaaaaaggatgatgaaacagttgacagtttgggccccttggag
aaaggacaggtgaagaatgaagccctgagagagctaagagttgaactcagcaaaaagcac
caggcacgagaacttgacggatttggcctttatctatatggggtggtgcttcggaagctg
gacttggtaaaagaggccattgatgtttttgtggaagcgacccacattttacctttacac
tggggagcctggctggagctatgtaacctgatcacagacaaagagatgctgaagttcctg
tctttgccagacacttggatgaaggaattttttttggctcatatatatacagaattgcag
ctgatagaggaggccctacagaagtatcagtctctcattgatgtgggcttttctaagagc
acgtacatcatttctcaaattgcggttgcctatcacaatattagagatattgacaaagcc
ctctctatattcaatgaattaaggaaacaagacccctacaggattgaaaatatggataca
ttctccaatttgctctatgttaggagtatgaaacctgaactgagctatctggctcataat
ctgtgtgaaattgacaaatatcgggtagagacctgctgtgtaataggtaattactacagc
ttacgttcccagcatgagaaagcagccctttattttcagagagccctaaaattaaatccc
cgctatcttggggcttggactctcatgggacatgagtacatggaaatgaagaatacatct
gcagctattcaagcttacagacatgctattgaggtaaacaagagagattacagagcctgg
tatggccttggacaaacctatgaaattcttaagatgccattttactgcctttattactat
cgacgggctcaccaactccgacccaatgattcccgtatgctggtggccctaggagaatgt
tacgagaaactcaatcagctcgtggaagccaaaaagtgttactggagagcttacgctgtg
ggagatgtggagaaaatggctctcgtgaaactagcaaaactccacgaacagttgactgaa
tcagaacaagctgcccagtgttacatcaaatacattcaggatatctattcatgtggggaa
atagtggagcacctggaggtgagcactgctttccgatatctggctcagtactactttaaa
tgcaaactctgggatgaagcctcggcctgtgcacagaaatgttgttcgttcaatgatact
cgagaagaaggtaaagccctacttagacagatcttacagttgcggaatcaaggagaaact
tccaccacagagatatctgctcccttttttctacctgcatcactgtctgctaacaacaca
cctacacgcagggtgtctccactcaacctatcttcagtcacaccatag

DBGET integrated database retrieval system