KEGG   Sarcophilus harrisii (Tasmanian devil): 100921308
Entry
100921308         CDS       T02286                                 

Gene name
MYC
Definition
(RefSeq) myc proto-oncogene protein
  KO
K04377  Myc proto-oncogene protein
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr04010  MAPK signaling pathway
shr04012  ErbB signaling pathway
shr04110  Cell cycle
shr04151  PI3K-Akt signaling pathway
shr04218  Cellular senescence
shr04310  Wnt signaling pathway
shr04350  TGF-beta signaling pathway
shr04390  Hippo signaling pathway
shr04550  Signaling pathways regulating pluripotency of stem cells
shr04630  JAK-STAT signaling pathway
shr04919  Thyroid hormone signaling pathway
shr05132  Salmonella infection
shr05160  Hepatitis C
shr05161  Hepatitis B
shr05163  Human cytomegalovirus infection
shr05166  Human T-cell leukemia virus 1 infection
shr05167  Kaposi sarcoma-associated herpesvirus infection
shr05169  Epstein-Barr virus infection
shr05200  Pathways in cancer
shr05202  Transcriptional misregulation in cancer
shr05205  Proteoglycans in cancer
shr05206  MicroRNAs in cancer
shr05210  Colorectal cancer
shr05213  Endometrial cancer
shr05216  Thyroid cancer
shr05219  Bladder cancer
shr05220  Chronic myeloid leukemia
shr05221  Acute myeloid leukemia
shr05222  Small cell lung cancer
shr05224  Breast cancer
shr05225  Hepatocellular carcinoma
shr05226  Gastric cancer
shr05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:shr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100921308 (MYC)
   04012 ErbB signaling pathway
    100921308 (MYC)
   04310 Wnt signaling pathway
    100921308 (MYC)
   04350 TGF-beta signaling pathway
    100921308 (MYC)
   04390 Hippo signaling pathway
    100921308 (MYC)
   04630 JAK-STAT signaling pathway
    100921308 (MYC)
   04151 PI3K-Akt signaling pathway
    100921308 (MYC)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100921308 (MYC)
   04218 Cellular senescence
    100921308 (MYC)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100921308 (MYC)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    100921308 (MYC)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100921308 (MYC)
   05202 Transcriptional misregulation in cancer
    100921308 (MYC)
   05206 MicroRNAs in cancer
    100921308 (MYC)
   05205 Proteoglycans in cancer
    100921308 (MYC)
   05230 Central carbon metabolism in cancer
    100921308 (MYC)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100921308 (MYC)
   05225 Hepatocellular carcinoma
    100921308 (MYC)
   05226 Gastric cancer
    100921308 (MYC)
   05216 Thyroid cancer
    100921308 (MYC)
   05221 Acute myeloid leukemia
    100921308 (MYC)
   05220 Chronic myeloid leukemia
    100921308 (MYC)
   05219 Bladder cancer
    100921308 (MYC)
   05213 Endometrial cancer
    100921308 (MYC)
   05224 Breast cancer
    100921308 (MYC)
   05222 Small cell lung cancer
    100921308 (MYC)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100921308 (MYC)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100921308 (MYC)
   05161 Hepatitis B
    100921308 (MYC)
   05160 Hepatitis C
    100921308 (MYC)
   05163 Human cytomegalovirus infection
    100921308 (MYC)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100921308 (MYC)
   05169 Epstein-Barr virus infection
    100921308 (MYC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:shr03000]
    100921308 (MYC)
   03019 Messenger RNA biogenesis [BR:shr03019]
    100921308 (MYC)
Transcription factors [BR:shr03000]
 Eukaryotic type
  Basic helix-loop-helix/leucine zipper (bHLH-ZIP)
   Cell cycle controlling factors, Myc
    100921308 (MYC)
Messenger RNA biogenesis [BR:shr03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     100921308 (MYC)
SSDB
Motif
Pfam: Myc_N HLH Myc-LZ
Other DBs
NCBI-GeneID: 100921308
NCBI-ProteinID: XP_012397269
LinkDB
Position
1
AA seq 451 aa
MPLSASSPSKTYDYDYDSVQPYFYFDEEENFYQQQQHSELQPPAPSEDIWKKFELLPTPP
LSPSRRSSLSSSSSSAGGGGGGGGGGGAVPSTADQLEMVTELLGGDMVNQSFICDPDDES
FVKSIIIHDCMWSGFSAAAKLVSEKLASYQATRKDGSWASRHSAPPTHSLYLQDMHTAAS
ECIDPSVVFPYPLSESSSPKRCPSPVSSSFSTSTSSLMSSVASSPRASPEPLALCEDTPP
TTSSSSSSSSSSSSSSSSSSSSDSEEEQEDEEEIDVVTVEKRQPSTRRSESSSHTAGGHS
KPPHSPLVLKRCHVPTHQHNYAAPPSTKKDYPSAKRIKLDSGRILKQISNNRKCASPRSS
DTEENDKRRTHNVLERQRRNELKLSFFALRDQIPELENNEKAPKVVILKKATAYIISIQA
EEQKLSTESELLRKEQLQLKLKLERLQNSCA
NT seq 1356 nt   +upstreamnt  +downstreamnt
atgcctctcagcgccagctcccccagcaaaacctacgactatgattacgattcggtgcag
ccctacttctactttgacgaagaggagaacttctaccagcagcagcagcacagcgagctg
cagccgccggctcccagcgaggatatctggaagaagttcgagctgctgcccactcctccc
ctgtcccccagccgccgctccagcctctcctcctcctcctcgtctgccggcggcggcggg
gggggcggcggggggggcggcgcggtgccctccacggcggaccagctggagatggtgacc
gagctgctcggcggggacatggtcaaccagagtttcatctgcgacccggacgacgagtcc
ttcgtcaagtccatcatcattcatgactgcatgtggagcggcttctcggccgcggccaag
ctggtctcggaaaagctggcctcctaccaggccactcgcaaagacggctcctgggcctcc
cggcacagcgcgcccccgacgcacagcctctacttgcaagacatgcacacggcggcctcc
gagtgcatcgacccctcggtggtcttcccctacccgctcagcgaaagcagctcgcccaag
cgctgcccctccccggtctcctcctccttctccacctccacctcctccctgatgtcctcg
gtggcctcctccccccgggccagcccggagcccctggcgctctgcgaggacacgccgccc
accaccagcagcagcagcagcagcagcagcagcagtagcagcagcagcagcagcagcagc
agcagcgactcggaagaagaacaagaggatgaggaagagattgatgttgttacagttgaa
aagaggcagccctcgacaagaagatcagaatccagctcccacacagctggaggccacagt
aaacctccccacagcccccttgtcttgaagaggtgtcatgtccccacccatcagcacaac
tatgctgcgcccccctccacaaagaaagactatccctctgctaagaggattaagttggac
agtggcagaatcctcaaacaaattagcaacaaccgaaaatgtgccagccccaggtcctca
gacactgaggagaatgacaagaggaggacacacaacgtcttagagcgccagcggagaaat
gaactgaagttaagcttcttcgccttgcgagaccagatccccgagttagagaacaatgag
aaggcccccaaagttgtcattctcaaaaaggccacagcttatatcatatctatccaggca
gaggagcaaaaattgtctacagagagtgagctgttgaggaaagaacaacttcagttgaaa
ctcaaacttgaacggctgcagaactcttgtgcataa

DBGET integrated database retrieval system