KEGG   Sarcophilus harrisii (Tasmanian devil): 100921733Help
Entry
100921733         CDS       T02286                                 

Gene name
GSTZ1
Definition
(RefSeq) maleylacetoacetate isomerase isoform X2
  KO
K01800  maleylacetoacetate isomerase [EC:5.2.1.2]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr00350  Tyrosine metabolism
shr01100  Metabolic pathways
Module
shr_M00044  Tyrosine degradation, tyrosine => homogentisate
Brite
KEGG Orthology (KO) [BR:shr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    100921733 (GSTZ1)
Enzymes [BR:shr01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.2  maleylacetoacetate isomerase
     100921733 (GSTZ1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_2 GST_N_3 GST_N GST_C_3 GST_C Glutaredoxin GST_C_5
Motif
Other DBs
NCBI-GeneID: 100921733
NCBI-ProteinID: XP_003756257
Ensembl: ENSSHAG00000006823
UniProt: G3VXF7
LinkDB All DBs
Position
1
AA seq 217 aa AA seqDB search
MQAGKPVLYSYFRSSCSWRVRIALALKGIDYDILPISLIKDGGQQFTKEFKTLNPMSQVP
TLKIDGIILTQSLAIIEYLEETRPTPVRLLPQDPKKRAHVRMISDLIASGIQPLQNLSVL
KKVGQETQLAWAQAVINSGFGALEHVLQSTAGKYCVGNEISMADLCLVPQVANAERFKVD
LSSYPTINRINKTLLTMEAFQVSHPSRQPDTPPEFQA
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgcaggcgggaaagccggtcctctattcttatttccgaagctcttgttcctggagagtt
cgaatagctctggctctcaaggggattgactacgatatccttcccattagcctcataaaa
gatggggggcagcagtttacaaaggaatttaagacgctgaaccctatgagtcaagtgcca
accctgaagattgatggcattatccttactcagtcactggccatcattgagtatctggaa
gagacacgaccgacaccggtcaggctcctgccgcaggaccccaagaaaagagcccatgtt
cgcatgatctcggatctcattgctagtggaattcagcctctgcagaacctctctgtccta
aagaaagtgggccaagagacccagctggcgtgggcacaagcagtcatcaactctggcttt
ggagctctagaacatgttctgcagagtacagcagggaaatactgtgtgggaaatgagatc
tccatggctgacttatgcctagtacctcaggtggccaatgctgagaggtttaaggtggac
ctttcctcataccccaccatcaaccgcatcaacaagaccttgcttaccatggaggctttc
caagtgagccacccttcccggcagcctgacacccctccagaatttcaggcctaa

DBGET integrated database retrieval system