KEGG   Sarcophilus harrisii (Tasmanian devil): 100921789
Entry
100921789         CDS       T02286                                 

Gene name
AIM2
Definition
(RefSeq) interferon-inducible protein AIM2
  KO
K12966  absent in melanoma 2
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr04621  NOD-like receptor signaling pathway
shr04623  Cytosolic DNA-sensing pathway
Brite
KEGG Orthology (KO) [BR:shr00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100921789 (AIM2)
   04623 Cytosolic DNA-sensing pathway
    100921789 (AIM2)
SSDB
Motif
Pfam: HIN PYRIN tRNA_anti-codon Peroxin-3 DUF2950 RP-C_C
Other DBs
NCBI-GeneID: 100921789
NCBI-ProteinID: XP_012403472
LinkDB
Position
4
AA seq 401 aa
MSTRLNPTDEMMSKLGEILLESLTELDEEEFKICKYHLKNRGLIIRMEGKGDRTDIAESM
KAKFGAVSALKHITNVFKKMNLNEIVENLQAKKAQVEKEYNKKKEKKPVTRDDQTQMRKT
ASNGNDNIGKLQLTKKSNLKSTSETKDQVVKKRKAQTEDGQEIKKVKTSQQSLQKTKPEA
EREDGLQTMPMVVMVLKVKETFEYDTQKGKKEMFHAIVANEHEFIRVKVLNMNVKEQFKK
NKVIEISKAYWNRGFLEINKCSRVEDMTTNKEIIVPKNIIRKAAKTTKLQMLKTLKPGSY
VDGVYEIHKKTEKENCTFFEVKDNTGNIKVVVFGKWAKIKSEKGDKLRLTCFEYNSFGDE
MQLKSVTHSCIQVIKAKKIRKIAGEQIDSPDIVSSLSTGVL
NT seq 1206 nt   +upstreamnt  +downstreamnt
atgtcaacaagactgaatccaactgatgagatgatgagtaaattgggggaaattttacta
gagtcattgacagaactggatgaagaagaatttaaaatatgtaaataccatctaaagaac
agaggtttgatcatcaggatggaaggaaaaggcgatcgaactgacatagctgaatctatg
aaagcaaagtttggcgctgtctctgctctgaagcatatcactaacgtatttaagaaaatg
aatcttaatgaaattgttgagaatcttcaagcaaaaaaagcccaagttgagaaggaatac
aataagaaaaaagagaagaaaccagtgacaagagacgatcagactcaaatgagaaaaaca
gcttctaacggcaatgataacattggtaaacttcagctaaccaagaaaagtaacctgaaa
tccaccagtgagacaaaggaccaagttgttaagaaaagaaaagcacaaactgaagatgga
caagagatcaaaaaagtaaagacatcccagcaatccctccagaaaacaaaaccagaagct
gaaagagaagatggtctccagacaatgcccatggtagtaatggttctcaaagtgaaggag
acatttgagtatgatacccaaaaaggaaagaaagagatgtttcatgccattgtggcaaat
gagcatgaatttatccgggtaaaggttctcaacatgaatgtcaaggaacaattcaagaaa
aataaggtcatcgaaatctcaaaagcttattggaacagaggtttcctagaaataaataaa
tgttccagggtagaagatatgactactaacaaagaaatcatagtacccaaaaacatcatc
agaaaagcggctaaaaccacaaagctccaaatgcttaaaacactaaaaccaggaagctat
gtggatggtgtttatgagatccataagaaaaccgagaaagagaattgtacattctttgaa
gtgaaggacaacacaggaaatattaaagtggtggtatttggcaaatgggccaaaataaag
agtgagaaaggagacaaacttcggcttacctgctttgagtataacagttttggggatgaa
atgcaactgaaatctgtaactcatagctgcatccaggtcatcaaggctaaaaaaattaga
aagatagctggagaacaaattgatagtcctgatattgtctcctctctgtcaactggagtt
ttgtga

DBGET integrated database retrieval system