KEGG   Sarcophilus harrisii (Tasmanian devil): 100922258Help
Entry
100922258         CDS       T02286                                 

Gene name
SUV39H1
Definition
(RefSeq) histone-lysine N-methyltransferase SUV39H1 isoform X1
  KO
K11419  histone-lysine N-methyltransferase SUV39H [EC:2.1.1.43]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:shr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    100922258 (SUV39H1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:shr03036]
    100922258 (SUV39H1)
Enzymes [BR:shr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100922258 (SUV39H1)
Chromosome and associated proteins [BR:shr03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     100922258 (SUV39H1)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    100922258 (SUV39H1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET Pre-SET Chromo
Motif
Other DBs
NCBI-GeneID: 100922258
NCBI-ProteinID: XP_023362951
Ensembl: ENSSHAG00000000138
LinkDB All DBs
Position
X
AA seq 373 aa AA seqDB search
MCRVAKLCCHDLGITKKNMCIFEVDYLCNYKKIDDKEYYLVKWKGYPKSENTWEPRRNLR
CAATLKQFHRDLEGELFRRSRRRPRVWPPRHLDAAILSFLEQKGEQRKALRRWEKELNLA
RAHKGSIAVENEVDLFWPPEDFTYINEYRVTEGITLDQVTTGCRCKNCLESPVNGCCPGT
NLNRFAYNIQGQVRLEAGQPIYECNSHCLCDMQCANRVVQRGTYYNLCIFRTDNGRGWGV
RTQEKIRCHTFVMEYVGEIITSEEAERRGRVYDRQGITYLFDLDYVEDVYTVDAAHFGNI
SHFINHSCCPNLQVYNVFVDNLDQRLPRIAFFATRTIRAGEELTFDYNMQGSPKKRVRIA
CKCGAEFCRKYLF
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgtgccgtgtggctaagctctgctgccatgatctcggcatcacaaagaagaacatgtgc
atctttgaggtggattatctgtgcaactacaagaagattgatgataaagagtactacctg
gtcaagtggaaaggttaccccaaatccgaaaacacttgggagccacgccggaacctgaga
tgcgctgccaccttgaagcagttccaccgagacttggagggagagttgttccgccgcagt
aggcggcggccccgggtctggccccctcgccacctggatgccgctatcctcagttttctg
gagcagaagggcgagcagcgcaaggccctgcggcgttgggagaaggagctgaatctcgca
cgggctcacaagggctccatcgcagtggaaaacgaagtggacttattttggcccccggag
gacttcacctacatcaatgaatacagagtgaccgaagggatcactctggaccaggtgacc
actggctgcagatgcaagaactgtctggagtccccagtcaacggctgctgccctggcacg
aacctcaaccgatttgcctacaacatccaaggtcaggtgcggctggaagctggtcagccc
atctacgagtgcaactcgcactgcctctgtgacatgcagtgcgccaaccgcgtggtccag
agaggcacctactacaacctgtgcatcttccgcacggacaatggacggggctggggcgtc
cgcacccaggagaagattcgctgccacacctttgtcatggagtatgtgggtgagatcatt
acctctgaggaggcagaacggcgtgggcgggtctatgatcgccaggggatcacctacctc
tttgatttggactatgtggaagatgtctacacagtggatgcagcacattttgggaacatc
tcccactttatcaaccatagctgctgccccaacctccaggtctacaatgtcttcgttgat
aatctggaccagcgccttccacgaattgccttttttgccacccgaactatccgggcaggc
gaggagttaacctttgactacaacatgcaaggctctcccaagaagcgggtgcggattgcg
tgcaaatgtggagctgaattctgccggaagtacctcttctaa

DBGET integrated database retrieval system