KEGG   Sarcophilus harrisii (Tasmanian devil): 100922331
Entry
100922331         CDS       T02286                                 

Gene name
TRAF6
Definition
(RefSeq) TNF receptor-associated factor 6
  KO
K03175  TNF receptor-associated factor 6 [EC:2.3.2.27]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr04010  MAPK signaling pathway
shr04064  NF-kappa B signaling pathway
shr04120  Ubiquitin mediated proteolysis
shr04140  Autophagy - animal
shr04144  Endocytosis
shr04380  Osteoclast differentiation
shr04620  Toll-like receptor signaling pathway
shr04621  NOD-like receptor signaling pathway
shr04622  RIG-I-like receptor signaling pathway
shr04657  IL-17 signaling pathway
shr04722  Neurotrophin signaling pathway
shr05132  Salmonella infection
shr05133  Pertussis
shr05135  Yersinia infection
shr05140  Leishmaniasis
shr05142  Chagas disease
shr05145  Toxoplasmosis
shr05152  Tuberculosis
shr05160  Hepatitis C
shr05161  Hepatitis B
shr05162  Measles
shr05168  Herpes simplex virus 1 infection
shr05169  Epstein-Barr virus infection
shr05170  Human immunodeficiency virus 1 infection
shr05171  Coronavirus disease - COVID-19
shr05200  Pathways in cancer
shr05222  Small cell lung cancer
shr05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:shr00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100922331 (TRAF6)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100922331 (TRAF6)
   04064 NF-kappa B signaling pathway
    100922331 (TRAF6)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100922331 (TRAF6)
   04140 Autophagy - animal
    100922331 (TRAF6)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100922331 (TRAF6)
   04621 NOD-like receptor signaling pathway
    100922331 (TRAF6)
   04622 RIG-I-like receptor signaling pathway
    100922331 (TRAF6)
   04657 IL-17 signaling pathway
    100922331 (TRAF6)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100922331 (TRAF6)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100922331 (TRAF6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100922331 (TRAF6)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100922331 (TRAF6)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100922331 (TRAF6)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100922331 (TRAF6)
   05135 Yersinia infection
    100922331 (TRAF6)
   05133 Pertussis
    100922331 (TRAF6)
   05152 Tuberculosis
    100922331 (TRAF6)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100922331 (TRAF6)
   05161 Hepatitis B
    100922331 (TRAF6)
   05160 Hepatitis C
    100922331 (TRAF6)
   05171 Coronavirus disease - COVID-19
    100922331 (TRAF6)
   05162 Measles
    100922331 (TRAF6)
   05168 Herpes simplex virus 1 infection
    100922331 (TRAF6)
   05169 Epstein-Barr virus infection
    100922331 (TRAF6)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100922331 (TRAF6)
   05140 Leishmaniasis
    100922331 (TRAF6)
   05142 Chagas disease
    100922331 (TRAF6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:shr04131]
    100922331 (TRAF6)
   04121 Ubiquitin system [BR:shr04121]
    100922331 (TRAF6)
Enzymes [BR:shr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     100922331 (TRAF6)
Membrane trafficking [BR:shr04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    100922331 (TRAF6)
Ubiquitin system [BR:shr04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRAF proteins
    100922331 (TRAF6)
SSDB
Motif
Pfam: zf-TRAF zf-C3HC4_2 zf-C3HC4 zf-RING_2 zf-C3HC4_3 zf-RING_UBOX zf-C3HC4_4 SlyX zf-TRAF_2 TRAF6_Z2 zf-RING_5 Tropomyosin_1 zf-RING_11 DUF4455 U-box CENP-F_leu_zip PspA_IM30 Spc29 DUF1664 Tropomyosin CENP-Q DUF16 zf-U1 PI3K_P85_iSH2 NPV_P10 DHR10 Med21 TMF_DNA_bd ATG16 UPF0242
Other DBs
NCBI-GeneID: 100922331
NCBI-ProteinID: XP_012408031
Ensembl: ENSSHAG00000013890
UniProt: G3WLM2
LinkDB
Position
6
AA seq 530 aa
MSLLNCEDSCGGNQPESDCCPAMASACSTGAKEDSINGSPVPGNLSSSLMEEIQGYDVEF
DPPLESKYECPICLMALREAVQTPCGHRFCKACIVKSIRDAGHKCPVDNEILLENQLFPD
NFAKREILSLTVKCPNEGCLLKMELRHLEDHQTHCEFALVECSQCHLSFRKYLLHNHMLT
ECPRRQVSCVNCAAPMPFEEKEFHDQNCPLATVFCKYCNTMLIREQMPNHYDIDCPTAPI
PCTFSTFGCDKKMQRNHLARHLQEDTLAHMRMMAQAIQNISIAAFDPGVPRIPSGCHQEV
QNFQETIQQLESRLVMQDHQIRELTAKMETQSACVGDLKRTIRTLEDKITEMEAQQCNGI
YIWKINNFGMHLKSQEEEKPVVIHSPGFYTGKPGYKLCMRLHLQLPSAQRCANYISLFVH
TMQGEYDSHLPWPFQGTIRLTILDQSEAPVRQNHEEVMDAKPDLLAFQRPTIPRNPKGFG
YVTFMHLQALRQRTFIKDDTLLVRCEVLTRLDMNSLRREGFQPRSTDAGV
NT seq 1593 nt   +upstreamnt  +downstreamnt
atgagtctgctaaactgtgaagacagctgcggtggcaaccagccggaaagtgactgttgc
cccgccatggccagtgcctgcagcaccggtgccaaggaggacagcataaacgggagcccc
gttcctgggaacctttccagctccctgatggaagagattcaaggctatgatgtggagttt
gatccaccccttgaaagcaaatacgagtgtcccatctgtctgatggcgttacgggaagct
gtgcaaaccccatgtggccatcgcttctgcaaggcctgtattgtcaagtcaataagagac
gcgggtcacaaatgccctgtagataatgaaatactgctggaaaatcaactatttcctgac
aattttgctaaacgggaaatcctctcacttacagtgaaatgtccaaatgaaggttgtctg
ctgaaaatggaactgaggcatctagaggatcaccagacacattgtgagtttgcacttgtg
gaatgctcacagtgccacctttcctttcggaaatatctccttcacaatcatatgctcacg
gagtgtccaaggcggcaagtgtcatgtgtgaattgtgctgccccaatgccatttgaagag
aaagagttccatgaccagaactgtccactggcaacagtcttctgtaaatactgcaacacc
atgctcatccgcgaacagatgcctaatcactatgatatagattgcccaacagctccaatt
ccatgtacattcagtacatttgggtgtgataagaagatgcagaggaatcatttggcacgc
cacctgcaagaggatactctggcccacatgcgcatgatggcacaggccatccagaacatc
agcattgcagcttttgatccgggggtgccccggatcccctcaggatgccaccaggaggtt
cagaacttccaagaaaccatccagcagttggagagtcgccttgtgatgcaagaccatcaa
atccgagagctgacggccaagatggaaacgcagagtgcttgcgtaggggacctcaaacgg
accattcgaaccctcgaggacaagatcaccgagatggaggcgcagcagtgcaatggcatt
tacatctggaaaatcaacaactttgggatgcatttgaaatcccaagaagaggagaaaccc
gtagtcatccacagccctggattctacactgggaaacccggctataagctctgcatgcgc
cttcacctgcagctgcccagtgctcagcgctgcgctaactacatttccctttttgtccac
acgatgcaaggtgagtatgacagccatcttccctggcccttccagggcacgatacgcctt
actattcttgatcagtctgaagccccggtgaggcagaatcatgaagaggtaatggacgcc
aagccagatctgctggccttccagagacccaccatcccccggaaccccaaaggttttggc
tacgtaactttcatgcatttacaagcccttagacaaagaaccttcattaaagatgatact
ttacttgtgcgttgtgaggttttgacacgcctggacatgaatagcttacggagggaggga
tttcagccacgcagtactgacgcaggggtgtag

KEGG   Sarcophilus harrisii (Tasmanian devil): 100926344
Entry
100926344         CDS       T02286                                 

Gene name
TRAF3
Definition
(RefSeq) TNF receptor-associated factor 3 isoform X1
  KO
K03174  TNF receptor-associated factor 3
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr04064  NF-kappa B signaling pathway
shr04620  Toll-like receptor signaling pathway
shr04621  NOD-like receptor signaling pathway
shr04622  RIG-I-like receptor signaling pathway
shr04657  IL-17 signaling pathway
shr04668  TNF signaling pathway
shr05160  Hepatitis C
shr05161  Hepatitis B
shr05162  Measles
shr05164  Influenza A
shr05165  Human papillomavirus infection
shr05167  Kaposi sarcoma-associated herpesvirus infection
shr05168  Herpes simplex virus 1 infection
shr05169  Epstein-Barr virus infection
shr05171  Coronavirus disease - COVID-19
shr05200  Pathways in cancer
shr05203  Viral carcinogenesis
shr05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:shr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100926344 (TRAF3)
   04668 TNF signaling pathway
    100926344 (TRAF3)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100926344 (TRAF3)
   04621 NOD-like receptor signaling pathway
    100926344 (TRAF3)
   04622 RIG-I-like receptor signaling pathway
    100926344 (TRAF3)
   04657 IL-17 signaling pathway
    100926344 (TRAF3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100926344 (TRAF3)
   05203 Viral carcinogenesis
    100926344 (TRAF3)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100926344 (TRAF3)
  09172 Infectious disease: viral
   05161 Hepatitis B
    100926344 (TRAF3)
   05160 Hepatitis C
    100926344 (TRAF3)
   05171 Coronavirus disease - COVID-19
    100926344 (TRAF3)
   05164 Influenza A
    100926344 (TRAF3)
   05162 Measles
    100926344 (TRAF3)
   05168 Herpes simplex virus 1 infection
    100926344 (TRAF3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100926344 (TRAF3)
   05169 Epstein-Barr virus infection
    100926344 (TRAF3)
   05165 Human papillomavirus infection
    100926344 (TRAF3)
SSDB
Motif
Pfam: zf-TRAF ATG16 Crescentin MPS2 Sina Spc7 Cast Spc29 Tropomyosin_1 KxDL T3SSipB FliJ DUF1664 BLOC1_2 GAS SPATA24
Other DBs
NCBI-GeneID: 100926344
NCBI-ProteinID: XP_023359955
Ensembl: ENSSHAG00000009189
LinkDB
Position
2
AA seq 567 aa
MDSSKKMDPPAPLQTVQQKTNPDRGAGVSIYVPEQGGYKEKFVKPVEDKYKCEKCHLILC
NPKQTECGHRFCETCMHVLLSAPSPKCTACQENIIKDKVFKDNCCKREILALQIYCRNES
RGCTEQLTLGHLLVHLKSDCQFEELPCVRADCKEKILRKDLPGHVEKSCKYREATCQYCK
SQVPMITLQKHEDTDCPCVVVSCPHKCSVQTLLRSELNAHLSECINAPSTCSFKRYGCTF
QGTNQQIKTHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQICSFEIE
IERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSMKSSVESLQNRV
TELESVDKSAGQAARNTGLLETQLSRHDQMLSVHDIRLADMDLRFQVLETASYNGVLIWK
IRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGE
YDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFVAQT
VLENGTYIKDDTIFIKVIVDTSDLPDP
NT seq 1704 nt   +upstreamnt  +downstreamnt
atggattccagtaaaaagatggacccccctgctccactgcaaactgtacaacaaaagaca
aatcctgatcgtggtgctggcgtatcaatttatgttccagaacaagggggatacaaagaa
aaatttgtgaagcctgtggaagacaaatataagtgtgaaaagtgtcatctcattttgtgt
aatcccaagcagacagaatgtggtcaccgattctgtgaaacctgcatgcatgtcttgttg
agtgctccaagtccaaaatgtacagcatgtcaagaaaacatcattaaagataaggtattt
aaggataattgctgtaagagagaaattctggctcttcaaatatactgtaggaatgaaagc
agaggatgcacagaacaattaaccctgggacatttactggtacatttaaaaagtgattgc
caatttgaagaacttccatgtgtccgtgccgactgcaaagaaaaaatcctgcgaaaagat
ttaccaggccatgtagaaaagtcatgtaaataccgagaagcaacgtgtcagtactgtaaa
agtcaagttcccatgataacactgcagaaacatgaagatacagattgtccatgtgttgtt
gtctcatgcccacataaatgtagtgttcagacacttttgaggagtgagttgaatgcacat
ttgtcagaatgtattaatgccccaagtacctgtagttttaagcgttatggctgcactttt
cagggaacaaatcagcaaattaagacccatgaggccagttcagcagtgcaacatgttaat
ttgctgaaagaatggagtaattctctagaaaagaaggtttccttgctacagaatgaaagt
gtagaaaaaaacaaaagtatacaaagtttacacaatcagatttgtagctttgaaattgaa
attgaaagacaaaaagaaatgctccggaataatgaatccaaaatacttcatttacagcga
gtgattgatagtcaggctgagaagctaaaagaactggacaaagaaatacgtcccttccga
caaaactgggaggaggctgacagcatgaaaagcagtgtggaatccctccagaatcgagta
acagaactggaaagtgtggataaatctgcaggacaagcggcacgaaatacaggcttgctt
gagacacaattaagcagacatgaccagatgctaagcgttcatgatattcgactggctgac
atggaccttcgattccaagtcctagaaaccgccagctacaatggggtgttaatctggaaa
attcgagattataaacgacggaagcaagaagctgtcatggggaagaccttgtcgctgtat
agccagcctttctatactggctactttggctataagatgtgtgctagggtttaccttaat
ggggatgggatggggaaaggaactcacttgtctttgttttttgtcataatgcgtggagaa
tatgatgctttgcttccttggccatttaagcaaaaagtgactctcatgctaatggatcag
ggatcgtctcgtcgtcatttaggagatgctttcaaacctgacccaaacagcagtagtttc
aagaaacctacgggagagatgaacattgcatctgggtgccctgtctttgtggcccaaact
gttctagaaaatgggacgtatattaaagatgatactatttttattaaagtcatagtggat
acatcggatctgccagacccctga

KEGG   Sarcophilus harrisii (Tasmanian devil): 100926831
Entry
100926831         CDS       T02286                                 

Gene name
TRAF5
Definition
(RefSeq) TNF receptor-associated factor 5 isoform X2
  KO
K09849  TNF receptor-associated factor 5
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr04064  NF-kappa B signaling pathway
shr04217  Necroptosis
shr04621  NOD-like receptor signaling pathway
shr04657  IL-17 signaling pathway
shr04668  TNF signaling pathway
shr05163  Human cytomegalovirus infection
shr05168  Herpes simplex virus 1 infection
shr05169  Epstein-Barr virus infection
shr05170  Human immunodeficiency virus 1 infection
shr05200  Pathways in cancer
shr05203  Viral carcinogenesis
shr05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:shr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100926831 (TRAF5)
   04668 TNF signaling pathway
    100926831 (TRAF5)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100926831 (TRAF5)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100926831 (TRAF5)
   04657 IL-17 signaling pathway
    100926831 (TRAF5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100926831 (TRAF5)
   05203 Viral carcinogenesis
    100926831 (TRAF5)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100926831 (TRAF5)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100926831 (TRAF5)
   05168 Herpes simplex virus 1 infection
    100926831 (TRAF5)
   05163 Human cytomegalovirus infection
    100926831 (TRAF5)
   05169 Epstein-Barr virus infection
    100926831 (TRAF5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:shr04121]
    100926831 (TRAF5)
Ubiquitin system [BR:shr04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRAF proteins
    100926831 (TRAF5)
SSDB
Motif
Pfam: zf-TRAF zf-TRAF_2 zf-C3HC4 zf-RING_6 zf-C3HC4_2 zf-C3HC4_4 zf-RING_5 DUF4941 zf-RING_UBOX DUF5753 FlaC_arch RasGEF
Other DBs
NCBI-GeneID: 100926831
NCBI-ProteinID: XP_023357720
LinkDB
Position
4
AA seq 577 aa
MTRFLLMLTCIHFFSPSMASSNFEEQGSASSNFLPQNSSNYISLDFEPNMEYRFVEQLEE
RYKCAKCHSVLHNPHQTGCGHRFCENCILSLRELNAVSICPVDKEIIKLQEVFKDNCCKR
EVLNLQVFCKNAPQCAAKIILGRYQDHLLQCLFQSVQCSNECCQEKVLRKDLKDHLGLHC
QFRKETCPYCKKDIVVMNLQNHKEKICPEYLVSCPNNCLQIIPRTKVDEHITVCPEVEQE
CPYKHYGCPVKEKRINLKEHENSALREHMLLVLEKNSRLEEQISDLHKNLELKESKIQQL
SETVKKFEKEFRQFVQLFGKNGNLLANTQVLASHIDKSAWLETQVRELLEVANQQQNRLD
LRPLMNTIDTIKEKITLLETYDQRLVTLEDQTNRHDVHINVHKAQLNKNEERFKMLEGTC
YNGKLIWKVTDYRMKKREATEGRTVSIFSQPFYTSRCGYRLCARAYLNGDGSGKGTHLSL
YFVVMKGEFDSLLQWPFKQRVTMMLLDQSGKKNHITEIFKADPNSSSFKRPDGEMNIASG
CPRFVAHSILENSKNTYIKEDTLFMKVVVDLSDLEDL
NT seq 1734 nt   +upstreamnt  +downstreamnt
atgactagatttcttttgatgttgacatgtattcattttttctcccccagcatggcatcc
tcaaactttgaagaacaggggagtgcctccagcaacttccttccccagaattccagtaac
tacatatccttggactttgaacctaacatggagtacagatttgtggaacaattagaagaa
cgttataaatgtgcaaaatgccattctgtccttcacaacccacatcaaactggctgtgga
catcgattctgtgagaactgcattctatccttgagagaattaaatgcagtgtccatctgt
cctgtagacaaggagattatcaaactccaggaggtgtttaaagataattgctgcaaacga
gaagtgctcaacttacaggttttttgcaaaaatgctccccaatgtgctgccaagatcatt
ctggggcgataccaggatcacctcctacagtgtttatttcaatctgtgcaatgttctaat
gaatgctgtcaagaaaaagtccttcgaaaagatttgaaagatcacttgggtttacattgt
cagtttcgaaaggaaacatgtccatactgcaaaaaagatatagtggtgatgaatttacag
aatcacaaggaaaaaatttgcccagagtaccttgtatcttgtcccaataattgtttacag
attattccaagaactaaggttgatgagcatattactgtgtgtcctgaggtggaacaagaa
tgcccctataaacattatggctgtcctgtgaaggaaaaaaggataaatcttaaggaacat
gagaattctgctttaagagaacacatgcttctggttttagaaaagaattccagattagaa
gaacagatttctgacttgcacaagaacttagaactaaaagaaagtaaaattcagcagtta
agtgaaactgtaaagaaatttgaaaaggagtttaggcagtttgtacagctgtttggcaaa
aatggtaacttgctggcaaatacccaggttcttgccagtcacattgataaatctgcttgg
ttggaaacacaagtaagggagttattagaggtggctaaccagcagcaaaacagattggat
ctaagacctttgatgaatacaattgatactataaaggagaagatcactctgctggaaacc
tatgaccagagattggtcactttggaagaccaaacaaacagacatgatgtccacattaat
gttcataaagcccagctgaataaaaatgaagagcgatttaaaatgttagagggtacttgt
tataatggcaaattgatatggaaggtgacagactacaggatgaaaaaaagagaagcaact
gaaggccgcacagtgtccatattcagccagcctttctatactagccgctgtggctaccga
ctttgtgcaagagcttacttaaatggggatgggtcagggaaagggacacatttatcattg
tattttgtggtgatgaaaggggaattcgactcattgttgcagtggcctttcaaacagagg
gttaccatgatgcttttggaccagagtgggaaaaagaaccacattacagagattttcaag
gctgaccccaatagcagtagctttaaaaggcctgatggagagatgaacattgcatctggc
tgtcctcgctttgtggcccattccattctggagaacagcaagaatacctacatcaaagaa
gatacattgtttatgaaagtggtggtagatttgtctgaccttgaggacctgtaa

KEGG   Sarcophilus harrisii (Tasmanian devil): 100932053
Entry
100932053         CDS       T02286                                 

Gene name
TRAF1
Definition
(RefSeq) TNF receptor-associated factor 1
  KO
K03172  TNF receptor-associated factor 1
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr04064  NF-kappa B signaling pathway
shr04210  Apoptosis
shr04668  TNF signaling pathway
shr05200  Pathways in cancer
shr05202  Transcriptional misregulation in cancer
shr05203  Viral carcinogenesis
shr05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:shr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100932053 (TRAF1)
   04668 TNF signaling pathway
    100932053 (TRAF1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100932053 (TRAF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100932053 (TRAF1)
   05202 Transcriptional misregulation in cancer
    100932053 (TRAF1)
   05203 Viral carcinogenesis
    100932053 (TRAF1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100932053 (TRAF1)
SSDB
Motif
Pfam: TRAF_BIRC3_bd zf-C3HC4 zf-C3HC4_2
Other DBs
NCBI-GeneID: 100932053
NCBI-ProteinID: XP_023363148
LinkDB
Position
2
AA seq 502 aa
MAENPSDTVLVGPSLTPDENEFPFGYPTSICQSTPEPKYLCCGCHNVLKKAQQTLCGHRY
CSACLSWIVRISKNPICSRCKEENPQTVGDESFLSEEKAFIDAAINKEISELSVHCVISG
CGWTGLMKNFETHECGGISLKDHKQTVTKISTEEKDGLIPIEVQGMCSFADIGCSFKGSQ
EMVKEHEVSSLPEHLRLLLELVSQVKAHHSEKRGSGFSHAKPSGKPLERNLSDLQLQGAV
EVNGDLEADCFRAASSDSEEELALQRFMKEKLLAELQEKLLVFENIVTVLNKEMEASRLA
IAASVHQSGLTQDLILNLEQRVIDLQQTLAQKDLALTKLEQSLHLLEEASYDGVYLWKIT
NFTRRCHESACGRMISLLSPAFYTARYGYKLCLRIYFSGGGTRKGTHLSLFIVVMKGEYD
ALLEWPFRNKVTFMLLDQNNREHVIDSFHPDLTSDSFQRPQGESNTAIGRPMFFPLNKLQ
SPKHAYVKNDTVFLKCVIETNS
NT seq 1509 nt   +upstreamnt  +downstreamnt
atggcagagaatccttctgatactgtccttgtgggccccagcctcacccctgatgaaaat
gaattcccctttggataccctaccagtatctgccagagcacccctgagccaaagtactta
tgctgtggttgtcacaatgttctgaagaaggcccagcagaccctatgtggtcaccgctac
tgttctgcctgcctctcctggatagtgaggatcagcaagaaccctatctgttcaagatgc
aaagaggagaatcctcagactgtgggtgatgaaagtttcttatccgaggaaaaggctttc
attgacgctgccattaataaggagatctctgagcttagtgtgcattgtgtgatttctgga
tgcggctggactggtctcatgaagaatttcgagacacatgaatgtggaggaatctctttg
aaggaccacaagcagactgtgaccaagatcagcacagaagagaaggatggcttgattcca
attgaggtccagggaatgtgctcctttgcagacattggctgttccttcaagggtagccag
gaaatggtgaaagagcatgaggtttcctcactcccagagcacctgaggctgctgttagag
cttgtgagccaagtgaaggcccaccacagtgagaaaaggggctcaggtttcagccacgcc
aagccaagtgggaagcccctggagagaaacctgtcggacctacagctccaaggagccgtg
gaagtcaatggtgacttggaggccgactgctttcgggctgcctcctctgactctgaggag
gagctggccctgcagaggttcatgaaggagaagctgctggctgagctgcaagagaagctg
ctcgtgtttgagaacattgtgactgtcctgaacaaggagatggaggcttcccgcctggcc
atcgctgcctccgtgcaccagagtgggctgacccaggacctgatcctgaacttggagcag
cgggtcatagatttgcaacagaccctggcccagaaagatttagcgctgaccaaattggag
cagagcctccatctcctggaggaagcttcctatgatggcgtctacctatggaaaatcacc
aacttcaccaggagatgtcatgagtctgcatgtggaaggatgatcagtctgttatcacca
gctttttatactgctcgctatggctataaattatgccttcggatctacttcagtggaggt
ggaacaagaaaagggacacatctttcactctttatagtggtcatgaaaggggaatatgat
gctctcctggagtggcctttccgaaataaggtcacattcatgctgctggaccagaacaac
agagagcatgttatcgattcttttcacccagacctgacctcggactccttccagaggcct
cagggggaaagcaacacagccattggccgccctatgttcttcccactgaacaagctgcag
tcccccaaacacgcctatgtgaaaaatgacacggttttcctcaagtgtgtcatagaaacg
aactcatga

KEGG   Sarcophilus harrisii (Tasmanian devil): 100932711
Entry
100932711         CDS       T02286                                 

Gene name
TRAF4
Definition
(RefSeq) TNF receptor-associated factor 4
  KO
K09848  TNF receptor-associated factor 4
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr04657  IL-17 signaling pathway
shr05200  Pathways in cancer
shr05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:shr00001]
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    100932711 (TRAF4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100932711 (TRAF4)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100932711 (TRAF4)
SSDB
Motif
Pfam: zf-TRAF zf-C3HC4 zf-C3HC4_2 zf-RING_UBOX zf-C3HC4_4 zf-RING_6 zf-Nse zf-C3HC4_3 zf-RING_2 zf-RING_5 zf-TRAF_2 MATH Sina zf-RING_13 zf-C2HC_2 zf_C2HC_14 U-box
Other DBs
NCBI-GeneID: 100932711
NCBI-ProteinID: XP_031823562
LinkDB
Position
4
AA seq 470 aa
MPGFDYKFLEKPKRRLLCPLCGKAMREPVQVSTCGHRFCDTCLQEFLSEGVFKCPEDQLP
LDYAKIYPDPELEAQVLSLAIRCIHSEEGCRWTGGLRHLQGHLNSCGYNVVSCPNRCSAK
LSRRDLPTHLQRECPKRRLKCDFCGIDFTGEAYESHEGVCPQESVYCENKCGARMMRRLL
SQHMMTECPKRTQPCAYCSKEFVFDTIQNHQHQCPRYPVPCPNQCGMGSIPREDLPSHLK
ENCSTAPVLCPFKDAGCKHRCPKLAMGRHMEESVKPHLAMMCALVSRQRQELLELRRDVE
ELSVGCDGVLIWKIGGYGRRLQEAKARPNHECFSPAFYTHKYGYKLQVSAFLNGNGSGEG
THLSLYIRVLPGAFDNLLEWPFARRVTFSLLDQSDPAVTKPQHVTETFHPDPHWKNFQKP
GPWRGSVDESALGFGYPKFISHQDIRKRNYVRDDAVFIRASVELPKKILS
NT seq 1413 nt   +upstreamnt  +downstreamnt
atgcccggtttcgactacaagttcctggagaagcccaagcggcggctgctgtgcccgctg
tgcgggaaggccatgcgcgagcccgtgcaggtctcgacctgcggccaccgcttttgcgac
acctgcctgcaggagtttctcagtgaaggagtgtttaagtgtcccgaggaccagttgccc
ctggactatgccaagatttatcccgacccggagctcgaagctcaggtcttgagtctggcc
atccgctgcatccacagtgaggagggctgtcgctggaccggaggcctgcggcacctgcag
ggccacctcaactcctgcggctacaacgtggtgtcctgccccaaccgctgcagtgccaag
ctgagccgcagggacctgcccacccacctgcagcgggagtgccccaagaggcggctcaag
tgcgacttctgtggcatcgactttaccggggaagcctatgagagccatgagggggtctgc
ccacaggagagcgtgtactgtgagaacaaatgcggggcccgaatgatgcgccggctgctg
agccagcacatgatgaccgagtgccccaagcggacccagccttgtgcctactgctccaag
gagtttgtctttgataccatccagaaccaccagcaccagtgcccccgctaccctgtgccg
tgccccaaccagtgtggaatggggagcatcccgagggaggacttgcccagccacctaaaa
gagaactgcagcacagctcctgtcctgtgccccttcaaagacgcgggctgcaaacaccgg
tgccccaagctggccatgggccgccacatggaggagagcgtgaagccgcacctggccatg
atgtgcgcgctggtgagccggcagcggcaggagctgctggagctgcgcagggacgtggag
gagctctcggtgggctgcgacggcgtgctcatctggaagatcgggggctacgggcggcgc
ctgcaggaggccaaggctcgccccaaccacgagtgcttcagcccggccttctacacccac
aagtacggctacaagctccaggtctcggccttcctcaacggcaacggcagcggcgagggg
acgcacctgtccctgtacatccgggtgctgcccggtgccttcgacaacctgctggagtgg
cccttcgcccgccgcgtcaccttctccctgctggaccagagcgacccggccgtcaccaag
ccccagcacgtcacggagaccttccatccggacccccactggaagaacttccagaagccg
ggcccctggaggggctcggtggacgagagcgccctgggctttggctatcccaagttcatc
tcccaccaggacatccgcaagcgcaactatgtgcgtgatgatgccgtctttatccgggct
tcagtcgagctgcccaagaagatcctgagctaa

KEGG   Sarcophilus harrisii (Tasmanian devil): 100934749
Entry
100934749         CDS       T02286                                 

Gene name
TRAF2
Definition
(RefSeq) TNF receptor-associated factor 2 isoform X1
  KO
K03173  TNF receptor-associated factor 2 [EC:2.3.2.27]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr04010  MAPK signaling pathway
shr04064  NF-kappa B signaling pathway
shr04071  Sphingolipid signaling pathway
shr04141  Protein processing in endoplasmic reticulum
shr04210  Apoptosis
shr04217  Necroptosis
shr04380  Osteoclast differentiation
shr04621  NOD-like receptor signaling pathway
shr04622  RIG-I-like receptor signaling pathway
shr04657  IL-17 signaling pathway
shr04668  TNF signaling pathway
shr04920  Adipocytokine signaling pathway
shr04932  Non-alcoholic fatty liver disease
shr05010  Alzheimer disease
shr05014  Amyotrophic lateral sclerosis
shr05016  Huntington disease
shr05017  Spinocerebellar ataxia
shr05022  Pathways of neurodegeneration - multiple diseases
shr05132  Salmonella infection
shr05135  Yersinia infection
shr05160  Hepatitis C
shr05163  Human cytomegalovirus infection
shr05167  Kaposi sarcoma-associated herpesvirus infection
shr05168  Herpes simplex virus 1 infection
shr05169  Epstein-Barr virus infection
shr05170  Human immunodeficiency virus 1 infection
shr05200  Pathways in cancer
shr05203  Viral carcinogenesis
shr05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:shr00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100934749 (TRAF2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100934749 (TRAF2)
   04064 NF-kappa B signaling pathway
    100934749 (TRAF2)
   04668 TNF signaling pathway
    100934749 (TRAF2)
   04071 Sphingolipid signaling pathway
    100934749 (TRAF2)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100934749 (TRAF2)
   04217 Necroptosis
    100934749 (TRAF2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100934749 (TRAF2)
   04622 RIG-I-like receptor signaling pathway
    100934749 (TRAF2)
   04657 IL-17 signaling pathway
    100934749 (TRAF2)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    100934749 (TRAF2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100934749 (TRAF2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100934749 (TRAF2)
   05203 Viral carcinogenesis
    100934749 (TRAF2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100934749 (TRAF2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100934749 (TRAF2)
   05014 Amyotrophic lateral sclerosis
    100934749 (TRAF2)
   05016 Huntington disease
    100934749 (TRAF2)
   05017 Spinocerebellar ataxia
    100934749 (TRAF2)
   05022 Pathways of neurodegeneration - multiple diseases
    100934749 (TRAF2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100934749 (TRAF2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100934749 (TRAF2)
   05135 Yersinia infection
    100934749 (TRAF2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100934749 (TRAF2)
   05160 Hepatitis C
    100934749 (TRAF2)
   05168 Herpes simplex virus 1 infection
    100934749 (TRAF2)
   05163 Human cytomegalovirus infection
    100934749 (TRAF2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100934749 (TRAF2)
   05169 Epstein-Barr virus infection
    100934749 (TRAF2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:shr03019]
    100934749 (TRAF2)
   04121 Ubiquitin system [BR:shr04121]
    100934749 (TRAF2)
Enzymes [BR:shr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     100934749 (TRAF2)
Messenger RNA biogenesis [BR:shr03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     100934749 (TRAF2)
Ubiquitin system [BR:shr04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRAF proteins
    100934749 (TRAF2)
SSDB
Motif
Pfam: TRAF_BIRC3_bd zf-TRAF zf-C3HC4 zf-C3HC4_4 zf-RING_6 zf-RING_UBOX zf-C3HC4_3 zf-C3HC4_2 MATH Thioredoxin_3
Other DBs
NCBI-GeneID: 100934749
NCBI-ProteinID: XP_031807825
Ensembl: ENSSHAG00000007574
LinkDB
Position
2
AA seq 633 aa
MDLDSGLLGHLPNSATNLLHDLGGVTAPLCSSVSPSVTMGRLFFNNRTFSSGEQRQPDTP
WSLISMGHGQNAAKVSLTSGQDPEQVVSDTGPVSPVLDQGLETHLGVVAHMATANSTPPG
SLDLLQPGFSKDILGTKLEDKYLCSACKNILRRPFQAQCGHRYCSYCLTSIISTGPQNCA
ACIQEGIYEEGISILESSSAFPDNAARREVESLPAICVNDGCTWKGTIKEYESCHEGHCP
FMLIECPACKWMIKLGEKEHHSERECPKRSLNCRYCKALFYYPDIKAHDEVCPKFPLTCE
GCGKKKILREKFQDHVKACGKCKGPCKFHVVGCTEMVENEKQQDHEIQKVAEHLCMLLNF
VLEARNFHGDIGPLLGQGDMGGWGNNSLTLGSEVSKSSELLERCETLERKTVTFENIVCV
LNREVERVSMTAEACSRQHRLDQEKIETLSTKVQQLERSIGLKDLAMADMEQKILEMEAS
TYDGIFIWKITDFARKRQEAMAGRSPAIFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLS
LFFVVMKGPNDALLRWPFNQKVTLMLLDQNNREHVIDAFRPDVTSSSFQRPVSDMNIASG
CPLFCPVSKMESKNSYVRDDAIFIKAIVDLTGL
NT seq 1902 nt   +upstreamnt  +downstreamnt
atggaccttgattctgggctcctgggtcatcttcccaactctgctactaatctcttgcat
gatcttggtggagtcactgctcccctctgttcctcagtttctccgtctgtaacaatgggg
agattatttttcaacaacagaacattttcctcgggtgagcagagacagcctgatactccc
tggagcctgatatcaatgggacatggacaaaatgcagcaaaagtttctctgacttctgga
caagaccctgaacaggtagtctctgatactggacctgtcagtccagttctggatcagggt
cttgaaactcatttgggggttgtagctcacatggcaacagcaaattctactcctccaggc
tctttagatttgcttcagcctggattttcaaaggatatcctaggaacaaaactagaagat
aaatatctctgctctgcatgcaagaacattttgagaagaccatttcaagctcagtgtgga
catcgttactgctcttattgtctgaccagcatcataagcactgggcctcagaattgtgct
gcctgcattcaggagggaatatatgaagaaggcatttctattttagaaagtagttcggct
tttccagataatgctgctcgaagagaggtagaaagcctaccagctatctgtgtcaatgat
ggttgcacatggaaaggcactataaaggaatatgagagctgccatgaaggacactgccca
ttcatgttaatcgagtgcccagcatgtaagtggatgatcaaactgggtgagaaggaacat
cattctgagcgggaatgcccaaagagaagcctcaactgcagatactgcaaagctcttttc
tactatcctgacattaaggcccatgatgaggtctgtcccaaatttcccttgacttgtgaa
ggttgtggtaagaaaaaaattcttcgagaaaaatttcaggaccatgtcaaggcctgtggc
aaatgcaaagggccctgcaaattccatgttgttggctgtaccgaaatggtggaaaatgag
aaacaacaggatcatgaaattcagaaggtggctgaacacctctgcatgttgttaaatttt
gtcctcgaggctaggaacttccatggagatattggtcccctcctcggccaaggagacatg
gggggctggggaaacaactcattgaccttagggtcagaggtgtccaaatcttcagagctg
ttggaaagatgtgaaaccttggaaagaaaaacagtcacttttgagaacattgtctgtgtc
ttgaaccgggaggtggagagagtgtccatgacagctgaagcttgcagcaggcagcatcgc
ctagaccaggagaaaatcgaaactctgagtaccaaggtccagcagctggaaaggagtata
ggattgaaagacctggcaatggctgacatggaacagaagatccttgagatggaagcttct
acttatgatggaattttcatatggaagataactgactttgctaggaaacgccaggaagcc
atggctggtcgctctcctgccatcttctctccagccttctacacgagcaaatatggctat
aagatgtgtttgagaatttatctgaatggggatggcactggacgtgggacccacctttct
cttttctttgtcgtgatgaaaggaccaaatgatgcacttctacgttggccctttaaccaa
aaggtgacattaatgctgctagatcagaacaaccgggaacatgtgattgatgccttcagg
cctgatgtgacatcttcctctttccaaaggccagtcagtgatatgaacattgccagtggc
tgccccctcttctgtcctgtctccaaaatggagtcaaagaattcttatgtgcgcgatgac
gccattttcatcaaagccatcgttgatttgacgggtctttaa

DBGET integrated database retrieval system