KEGG   Sarcophilus harrisii (Tasmanian devil): 100922473
Entry
100922473         CDS       T02286                                 

Gene name
TP53
Definition
(RefSeq) cellular tumor antigen p53 isoform X1
  KO
K04451  tumor protein p53
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr01522  Endocrine resistance
shr01524  Platinum drug resistance
shr04010  MAPK signaling pathway
shr04071  Sphingolipid signaling pathway
shr04110  Cell cycle
shr04115  p53 signaling pathway
shr04137  Mitophagy - animal
shr04151  PI3K-Akt signaling pathway
shr04210  Apoptosis
shr04211  Longevity regulating pathway
shr04216  Ferroptosis
shr04218  Cellular senescence
shr04310  Wnt signaling pathway
shr04722  Neurotrophin signaling pathway
shr04919  Thyroid hormone signaling pathway
shr05012  Parkinson disease
shr05014  Amyotrophic lateral sclerosis
shr05016  Huntington disease
shr05160  Hepatitis C
shr05161  Hepatitis B
shr05162  Measles
shr05163  Human cytomegalovirus infection
shr05165  Human papillomavirus infection
shr05166  Human T-cell leukemia virus 1 infection
shr05167  Kaposi sarcoma-associated herpesvirus infection
shr05168  Herpes simplex virus 1 infection
shr05169  Epstein-Barr virus infection
shr05200  Pathways in cancer
shr05202  Transcriptional misregulation in cancer
shr05203  Viral carcinogenesis
shr05205  Proteoglycans in cancer
shr05206  MicroRNAs in cancer
shr05210  Colorectal cancer
shr05212  Pancreatic cancer
shr05213  Endometrial cancer
shr05214  Glioma
shr05215  Prostate cancer
shr05216  Thyroid cancer
shr05217  Basal cell carcinoma
shr05218  Melanoma
shr05219  Bladder cancer
shr05220  Chronic myeloid leukemia
shr05222  Small cell lung cancer
shr05223  Non-small cell lung cancer
shr05224  Breast cancer
shr05225  Hepatocellular carcinoma
shr05226  Gastric cancer
shr05230  Central carbon metabolism in cancer
shr05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:shr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100922473 (TP53)
   04310 Wnt signaling pathway
    100922473 (TP53)
   04071 Sphingolipid signaling pathway
    100922473 (TP53)
   04151 PI3K-Akt signaling pathway
    100922473 (TP53)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    100922473 (TP53)
  09143 Cell growth and death
   04110 Cell cycle
    100922473 (TP53)
   04210 Apoptosis
    100922473 (TP53)
   04216 Ferroptosis
    100922473 (TP53)
   04115 p53 signaling pathway
    100922473 (TP53)
   04218 Cellular senescence
    100922473 (TP53)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    100922473 (TP53)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100922473 (TP53)
  09149 Aging
   04211 Longevity regulating pathway
    100922473 (TP53)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100922473 (TP53)
   05202 Transcriptional misregulation in cancer
    100922473 (TP53)
   05206 MicroRNAs in cancer
    100922473 (TP53)
   05205 Proteoglycans in cancer
    100922473 (TP53)
   05203 Viral carcinogenesis
    100922473 (TP53)
   05230 Central carbon metabolism in cancer
    100922473 (TP53)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100922473 (TP53)
   05212 Pancreatic cancer
    100922473 (TP53)
   05225 Hepatocellular carcinoma
    100922473 (TP53)
   05226 Gastric cancer
    100922473 (TP53)
   05214 Glioma
    100922473 (TP53)
   05216 Thyroid cancer
    100922473 (TP53)
   05220 Chronic myeloid leukemia
    100922473 (TP53)
   05217 Basal cell carcinoma
    100922473 (TP53)
   05218 Melanoma
    100922473 (TP53)
   05219 Bladder cancer
    100922473 (TP53)
   05215 Prostate cancer
    100922473 (TP53)
   05213 Endometrial cancer
    100922473 (TP53)
   05224 Breast cancer
    100922473 (TP53)
   05222 Small cell lung cancer
    100922473 (TP53)
   05223 Non-small cell lung cancer
    100922473 (TP53)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    100922473 (TP53)
   05014 Amyotrophic lateral sclerosis
    100922473 (TP53)
   05016 Huntington disease
    100922473 (TP53)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100922473 (TP53)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100922473 (TP53)
   05161 Hepatitis B
    100922473 (TP53)
   05160 Hepatitis C
    100922473 (TP53)
   05162 Measles
    100922473 (TP53)
   05168 Herpes simplex virus 1 infection
    100922473 (TP53)
   05163 Human cytomegalovirus infection
    100922473 (TP53)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100922473 (TP53)
   05169 Epstein-Barr virus infection
    100922473 (TP53)
   05165 Human papillomavirus infection
    100922473 (TP53)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100922473 (TP53)
   01522 Endocrine resistance
    100922473 (TP53)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:shr03000]
    100922473 (TP53)
   03036 Chromosome and associated proteins [BR:shr03036]
    100922473 (TP53)
   03400 DNA repair and recombination proteins [BR:shr03400]
    100922473 (TP53)
Transcription factors [BR:shr03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   p53
    100922473 (TP53)
Chromosome and associated proteins [BR:shr03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     100922473 (TP53)
DNA repair and recombination proteins [BR:shr03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    100922473 (TP53)
SSDB
Motif
Pfam: P53 P53_tetramer P53_TAD
Other DBs
NCBI-GeneID: 100922473
NCBI-ProteinID: XP_031821303
Ensembl: ENSSHAG00000015510
LinkDB
Position
4
AA seq 418 aa
MSSHTLGRAPLRLTQPGVDSTFAFGGGILSLPSPLAECHKTAFLRSTMEESLSDLEPPLS
QETFSDLWKLQWNNLPDDLSNIDDIQFASPDSINWLENEEENPGFQVSLPPVNLPTSSTV
PSQKDYPGDYGFRLGFLQSGTAKSVTCTYSPELNKLFCQLAKTCPVQLWVTSPPPAGARV
RAMAIYKKSEHMTEVVKRCPHHERCTEHKDALAPPQHLIRVEGNLRAEYLSDLTTKRQSV
SVPYESPEVGCDYTTVHYNYMCNSSCMGGMNRRPILTIITLEDSSGQLLGRRSFEVRVCA
CPGRDRRTEEENFRKKGGHNPQPSSESNKRALPTTPSSTPKTKKKLMDGEYFTLQIRGRH
RYELLRELNEALELKEAHSGKDPEGNCPHRSQLKSKRGDSTPCQGKRLLVKSEVADSD
NT seq 1257 nt   +upstreamnt  +downstreamnt
atgtcttcccacacacttggacgtgcccctctccgattaactcagcctggagtggactcg
acctttgcatttgggggagggatcctttccctcccttcccctttagctgagtgccacaaa
actgccttcttgaggtctaccatggaggaatcactgtcagatctggagcccccactgagt
caggaaaccttctcagacctatggaaattacaatggaacaatttaccagatgatttgtcg
aacatagatgatatacagtttgcctctccagatagtataaactggctggaaaatgaggaa
gaaaatcctggatttcaggtgtctttgcccccagttaacctgccaacatcatctactgtt
ccatcccaaaaggactatcctggagattatggtttcagacttggatttctacaatctgga
acagccaagtctgtcacctgcacgtactcccctgaactaaacaagctattttgccagctg
gccaagacctgccctgtccagctgtgggtcacttcaccaccacctgctggtgcccgagtc
cgtgctatggctatttataagaagtcagaacatatgactgaggtggttaagcgctgtccc
caccatgaaagatgtactgagcacaaagatgccttggcacccccacagcacctgattcga
gtggaaggaaacctacgggccgaataccttagtgatctcaccaccaagcgacagagtgtg
tccgtcccttatgagtccccagaggttgggtgtgattatactacagtccattacaactat
atgtgcaacagttcctgcatgggaggcatgaaccggcgtccaatcctcactatcataact
ctagaagactccagtggtcagcttcttggacgtcggagctttgaagtacgtgtatgtgcc
tgtcctggaagagaccgacgaactgaagaggaaaatttccggaagaagggaggtcacaat
ccacagccatcctctgagagcaataaacgtgcattgcctacaactcctagcagcactccc
aagactaaaaagaagttaatggatggagaatatttcaccctccagattcgaggtcgacac
cgctacgagctacttcgagagctgaatgaagccttggaactaaaagaagctcatagtggg
aaagaccctgaagggaactgtccccaccgcagtcaattgaagtccaagagaggagattct
accccctgtcaaggcaaaagacttttggtgaaaagtgaagttgctgactctgactga

DBGET integrated database retrieval system