KEGG   Sarcophilus harrisii (Tasmanian devil): 100922476Help
Entry
100922476         CDS       T02286                                 

Gene name
SOD2
Definition
(RefSeq) superoxide dismutase [Mn], mitochondrial
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr04068  FoxO signaling pathway
shr04146  Peroxisome
shr04211  Longevity regulating pathway
shr04213  Longevity regulating pathway - multiple species
shr05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:shr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100922476 (SOD2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    100922476 (SOD2)
 09150 Organismal Systems
  09149 Aging
   04211 Longevity regulating pathway
    100922476 (SOD2)
   04213 Longevity regulating pathway - multiple species
    100922476 (SOD2)
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05016 Huntington disease
    100922476 (SOD2)
Enzymes [BR:shr01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     100922476 (SOD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-GeneID: 100922476
NCBI-ProteinID: XP_003769623
Ensembl: ENSSHAG00000014795
UniProt: G3WPQ6
LinkDB All DBs
Position
4
AA seq 225 aa AA seqDB search
MATMLRRVVCRRTNRLVPTLGCLGSRQKHNLPDLPYDYGALEPHINAQIMQLHHSKHHAT
YVNNLNVTEEKYKEALAKGDVTAQVALQPALRFNGGGHINHTIFWTNLSPNGGGEPKGEL
MEAIKRDFGSFEKFKEKLTAVSVGVQGSGWGWLGFNKEQGRLKIASCSNQDPLQGTTGLI
PLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVSERYSACKK
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atggcaaccatgctccgcagggtggtgtgcaggagaaccaataggttagtaccaactttg
ggatgcttgggctccaggcaaaagcacaatctccctgacttgccttatgattatggtgca
ttggagcctcacattaatgcacagatcatgcagttgcatcacagcaaacatcatgccact
tatgtgaataacttgaatgttacagaagagaaatataaagaggctctggcaaagggtgat
gttactgctcaggtagctctccagcctgcactgcggttcaatggtggtggtcatatcaat
cacactattttctggacaaaccttagcccaaatggtggaggagaacccaaaggggaattg
atggaagccatcaaacgtgattttggttctttcgaaaaatttaaggagaagttgacagct
gtgtcagttggtgttcaaggttcaggatggggttggcttggcttcaataaggagcaagga
cggctgaagattgcttcttgttctaaccaagatcctttgcaaggaacaacaggtcttatt
cctctactgggaattgatgtgtgggaacatgcttattaccttcaatataaaaatgttaga
cctgattatctaaaagcaatctggaatgtaatcaattgggagaatgtatctgaaagatac
tcggcttgtaaaaagtag

DBGET integrated database retrieval system