KEGG   Sarcophilus harrisii (Tasmanian devil): 100922500
Entry
100922500         CDS       T02286                                 

Gene name
CASP3
Definition
(RefSeq) caspase-3
  KO
K02187  caspase 3 [EC:3.4.22.56]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr01524  Platinum drug resistance
shr04010  MAPK signaling pathway
shr04115  p53 signaling pathway
shr04210  Apoptosis
shr04215  Apoptosis - multiple species
shr04650  Natural killer cell mediated cytotoxicity
shr04657  IL-17 signaling pathway
shr04668  TNF signaling pathway
shr04726  Serotonergic synapse
shr04932  Non-alcoholic fatty liver disease
shr04933  AGE-RAGE signaling pathway in diabetic complications
shr05010  Alzheimer disease
shr05012  Parkinson disease
shr05014  Amyotrophic lateral sclerosis
shr05016  Huntington disease
shr05020  Prion disease
shr05022  Pathways of neurodegeneration - multiple diseases
shr05132  Salmonella infection
shr05133  Pertussis
shr05134  Legionellosis
shr05145  Toxoplasmosis
shr05146  Amoebiasis
shr05152  Tuberculosis
shr05160  Hepatitis C
shr05161  Hepatitis B
shr05162  Measles
shr05163  Human cytomegalovirus infection
shr05164  Influenza A
shr05165  Human papillomavirus infection
shr05167  Kaposi sarcoma-associated herpesvirus infection
shr05168  Herpes simplex virus 1 infection
shr05169  Epstein-Barr virus infection
shr05170  Human immunodeficiency virus 1 infection
shr05200  Pathways in cancer
shr05203  Viral carcinogenesis
shr05205  Proteoglycans in cancer
shr05206  MicroRNAs in cancer
shr05210  Colorectal cancer
shr05222  Small cell lung cancer
shr05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:shr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100922500 (CASP3)
   04668 TNF signaling pathway
    100922500 (CASP3)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100922500 (CASP3)
   04215 Apoptosis - multiple species
    100922500 (CASP3)
   04115 p53 signaling pathway
    100922500 (CASP3)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100922500 (CASP3)
   04657 IL-17 signaling pathway
    100922500 (CASP3)
  09156 Nervous system
   04726 Serotonergic synapse
    100922500 (CASP3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100922500 (CASP3)
   05206 MicroRNAs in cancer
    100922500 (CASP3)
   05205 Proteoglycans in cancer
    100922500 (CASP3)
   05203 Viral carcinogenesis
    100922500 (CASP3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100922500 (CASP3)
   05222 Small cell lung cancer
    100922500 (CASP3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100922500 (CASP3)
   05012 Parkinson disease
    100922500 (CASP3)
   05014 Amyotrophic lateral sclerosis
    100922500 (CASP3)
   05016 Huntington disease
    100922500 (CASP3)
   05020 Prion disease
    100922500 (CASP3)
   05022 Pathways of neurodegeneration - multiple diseases
    100922500 (CASP3)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100922500 (CASP3)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100922500 (CASP3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100922500 (CASP3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100922500 (CASP3)
   05133 Pertussis
    100922500 (CASP3)
   05134 Legionellosis
    100922500 (CASP3)
   05152 Tuberculosis
    100922500 (CASP3)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100922500 (CASP3)
   05161 Hepatitis B
    100922500 (CASP3)
   05160 Hepatitis C
    100922500 (CASP3)
   05164 Influenza A
    100922500 (CASP3)
   05162 Measles
    100922500 (CASP3)
   05168 Herpes simplex virus 1 infection
    100922500 (CASP3)
   05163 Human cytomegalovirus infection
    100922500 (CASP3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100922500 (CASP3)
   05169 Epstein-Barr virus infection
    100922500 (CASP3)
   05165 Human papillomavirus infection
    100922500 (CASP3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100922500 (CASP3)
   05145 Toxoplasmosis
    100922500 (CASP3)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100922500 (CASP3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:shr01002]
    100922500 (CASP3)
Enzymes [BR:shr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.56  caspase-3
     100922500 (CASP3)
Peptidases and inhibitors [BR:shr01002]
 Cysteine peptidases
  Family C14: caspase family
   100922500 (CASP3)
SSDB
Motif
Pfam: Peptidase_C14
Other DBs
NCBI-GeneID: 100922500
NCBI-ProteinID: XP_003773079
Ensembl: ENSSHAG00000009178
UniProt: G3W5D0
LinkDB
Position
6
AA seq 275 aa
MENTEITIDSKSSKSSGLKIFHGSKSVESGLSSDSYKMDYPEMGLCVIINNKNFHPNTGM
SFRSGTDVDAAHLRDTFKSLKYEVRNKNDLTCKEIIELLYNVSKEDHSQRSSFVCVILSH
GEEGIIFGTDGSVELKRLTYFFKGDKCKSLTGKPKLFIIQACRGTELDCGIETDSATDDV
TCQKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAVLKQYAYKLEIMQILTRVNRK
VATEFESYSLDATFHAKKQVPCIMSMLTKELYFFP
NT seq 828 nt   +upstreamnt  +downstreamnt
atggaaaatactgaaattacaatagattcaaagtcctccaaaagttcaggattaaagatc
ttccatggtagcaagtctgtggaatctggactgtcatcagacagctataaaatggattat
ccagaaatggggttatgtgtaatcataaataataaaaattttcacccaaacactggcatg
tcttttcggtctgggactgatgtagatgcagcacatctcagggatacattcaaaagcttg
aaatatgaagtcagaaataaaaatgatttgacatgtaaagaaataattgaattactttac
aatgtttctaaagaagatcacagccaaaggagcagttttgtttgtgtgattctaagtcat
ggtgaagaaggaatcatctttgggacagatggatctgttgaactgaaaagattaacatat
ttctttaaaggggataagtgtaaaagtcttacaggaaaaccaaagctttttatcattcag
gcatgtagaggcacagagttggattgtggtattgagacagatagtgccactgatgatgta
acatgccagaaaatacctgttgaggcagacttcttatatgcttattctacagccccaggt
tactattcttggagaaattcaaaggatggttcatggtttatccagtcactttgtgcagtg
ctgaaacagtatgcttacaagcttgaaatcatgcaaatccttaccagagtcaatcggaag
gttgccacagagtttgaatcttactccttagatgctaccttccatgcaaagaaacaggtg
ccatgtatcatgtccatgcttactaaggaactatattttttcccctaa

KEGG   Sarcophilus harrisii (Tasmanian devil): 100922757
Entry
100922757         CDS       T02286                                 

Definition
(RefSeq) caspase-3-like
  KO
K02187  caspase 3 [EC:3.4.22.56]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr01524  Platinum drug resistance
shr04010  MAPK signaling pathway
shr04115  p53 signaling pathway
shr04210  Apoptosis
shr04215  Apoptosis - multiple species
shr04650  Natural killer cell mediated cytotoxicity
shr04657  IL-17 signaling pathway
shr04668  TNF signaling pathway
shr04726  Serotonergic synapse
shr04932  Non-alcoholic fatty liver disease
shr04933  AGE-RAGE signaling pathway in diabetic complications
shr05010  Alzheimer disease
shr05012  Parkinson disease
shr05014  Amyotrophic lateral sclerosis
shr05016  Huntington disease
shr05020  Prion disease
shr05022  Pathways of neurodegeneration - multiple diseases
shr05132  Salmonella infection
shr05133  Pertussis
shr05134  Legionellosis
shr05145  Toxoplasmosis
shr05146  Amoebiasis
shr05152  Tuberculosis
shr05160  Hepatitis C
shr05161  Hepatitis B
shr05162  Measles
shr05163  Human cytomegalovirus infection
shr05164  Influenza A
shr05165  Human papillomavirus infection
shr05167  Kaposi sarcoma-associated herpesvirus infection
shr05168  Herpes simplex virus 1 infection
shr05169  Epstein-Barr virus infection
shr05170  Human immunodeficiency virus 1 infection
shr05200  Pathways in cancer
shr05203  Viral carcinogenesis
shr05205  Proteoglycans in cancer
shr05206  MicroRNAs in cancer
shr05210  Colorectal cancer
shr05222  Small cell lung cancer
shr05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:shr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100922757
   04668 TNF signaling pathway
    100922757
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100922757
   04215 Apoptosis - multiple species
    100922757
   04115 p53 signaling pathway
    100922757
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100922757
   04657 IL-17 signaling pathway
    100922757
  09156 Nervous system
   04726 Serotonergic synapse
    100922757
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100922757
   05206 MicroRNAs in cancer
    100922757
   05205 Proteoglycans in cancer
    100922757
   05203 Viral carcinogenesis
    100922757
  09162 Cancer: specific types
   05210 Colorectal cancer
    100922757
   05222 Small cell lung cancer
    100922757
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100922757
   05012 Parkinson disease
    100922757
   05014 Amyotrophic lateral sclerosis
    100922757
   05016 Huntington disease
    100922757
   05020 Prion disease
    100922757
   05022 Pathways of neurodegeneration - multiple diseases
    100922757
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100922757
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100922757
   04933 AGE-RAGE signaling pathway in diabetic complications
    100922757
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100922757
   05133 Pertussis
    100922757
   05134 Legionellosis
    100922757
   05152 Tuberculosis
    100922757
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100922757
   05161 Hepatitis B
    100922757
   05160 Hepatitis C
    100922757
   05164 Influenza A
    100922757
   05162 Measles
    100922757
   05168 Herpes simplex virus 1 infection
    100922757
   05163 Human cytomegalovirus infection
    100922757
   05167 Kaposi sarcoma-associated herpesvirus infection
    100922757
   05169 Epstein-Barr virus infection
    100922757
   05165 Human papillomavirus infection
    100922757
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100922757
   05145 Toxoplasmosis
    100922757
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100922757
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:shr01002]
    100922757
Enzymes [BR:shr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.56  caspase-3
     100922757
Peptidases and inhibitors [BR:shr01002]
 Cysteine peptidases
  Family C14: caspase family
   100922757
SSDB
Motif
Pfam: Peptidase_C14
Other DBs
NCBI-GeneID: 100922757
NCBI-ProteinID: XP_003773080
Ensembl: ENSSHAG00000009402
LinkDB
Position
6
AA seq 303 aa
MLRCSVGGSGLGYFSTLVERSTMENTEITVDSKSTQNSGVKIFHASKSVESSLSSDSYKM
DYPEMGLCVIINNKNFHQNTGMSFRSGTDVDEAHLIDTFKHLKYEIRNKNDLTCKEITEL
MYNVSKEDHSQRSSFVCVILSHGKEGIIYGKDGPVELKALTCFFKGDKCNSLIGKPKLFI
VQACRGTELDCGVEVDSGPDDNDTDEDITCQKIPVEADFLYAYSTAPGYFSWRNEKDGSW
FIQSLCAVLKQYAHKLEIMQILTRVNWKVATEFESYSLDATFHAKKQVPCIMSMLTKELY
FFP
NT seq 912 nt   +upstreamnt  +downstreamnt
atgctgcggtgcagcgtaggcggatctgggcttggctacttctctacgttagttgagaga
agcaccatggaaaatactgaaattacagtagattcaaaatctactcaaaattcaggagta
aagatcttccatgctagcaagtctgtggaatctagtctgtcatcagatagctataaaatg
gattatccagaaatgggattgtgtgtaatcatcaataataaaaattttcaccaaaacact
ggcatgtcatttcgatctggtacagatgtagacgaagcacatctcatagatactttcaag
cacttgaaatatgaaatcaggaataaaaatgatctgacatgcaaagaaattactgaatta
atgtacaatgtttctaaagaagatcacagccaacgaagcagttttgtttgtgtgattcta
agtcatggtaaagaaggaatcatttatggcaaggatggacctgttgaactgaaagcatta
acatgtttcttcaaaggggataaatgtaacagtctaataggaaaaccaaagctttttatt
gttcaggcatgtagaggcacagagttggattgtggtgttgaggtagacagtggccctgat
gacaatgacactgatgaggacataacatgccagaaaatacctgttgaggcagacttcttg
tatgcatattctacagccccaggttacttttcttggagaaatgaaaaggatggttcatgg
tttatccaatcactttgtgcagtgctgaaacaatatgctcacaagcttgaaatcatgcaa
atccttaccagagtcaattggaaggtcgccacagagtttgaatcttactccttagatgct
accttccatgcaaagaagcaggtgccatgtatcatgtccatgcttactaaggaactatat
tttttcccctaa

DBGET integrated database retrieval system