Sarcophilus harrisii (Tasmanian devil): 100922500 Help Entry 100922500         CDS       T02286                                  Gene name CASP3 Definition (RefSeq) caspase-3   KO K02187   caspase 3 [EC:3.4.22.56] Organism shr  Sarcophilus harrisii (Tasmanian devil) Pathway shr01524   Platinum drug resistance shr04010   MAPK signaling pathway shr04115   p53 signaling pathway shr04210   Apoptosis shr04215   Apoptosis - multiple species shr04650   Natural killer cell mediated cytotoxicity shr04657   IL-17 signaling pathway shr04668   TNF signaling pathway shr04726   Serotonergic synapse shr04932   Non-alcoholic fatty liver disease shr04933   AGE-RAGE signaling pathway in diabetic complications shr05010   Alzheimer disease shr05012   Parkinson disease shr05014   Amyotrophic lateral sclerosis shr05016   Huntington disease shr05020   Prion disease shr05022   Pathways of neurodegeneration - multiple diseases shr05132   Salmonella infection shr05133   Pertussis shr05134   Legionellosis shr05145   Toxoplasmosis shr05146   Amoebiasis shr05152   Tuberculosis shr05160   Hepatitis C shr05161   Hepatitis B shr05162   Measles shr05163   Human cytomegalovirus infection shr05164   Influenza A shr05165   Human papillomavirus infection shr05167   Kaposi sarcoma-associated herpesvirus infection shr05168   Herpes simplex virus 1 infection shr05169   Epstein-Barr virus infection shr05170   Human immunodeficiency virus 1 infection shr05200   Pathways in cancer shr05203   Viral carcinogenesis shr05205   Proteoglycans in cancer shr05206   MicroRNAs in cancer shr05210   Colorectal cancer shr05222   Small cell lung cancer shr05416   Viral myocarditis Brite KEGG Orthology (KO) [BR:shr00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     100922500 (CASP3)    04668 TNF signaling pathway     100922500 (CASP3)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     100922500 (CASP3)    04215 Apoptosis - multiple species     100922500 (CASP3)    04115 p53 signaling pathway     100922500 (CASP3)  09150 Organismal Systems   09151 Immune system    04650 Natural killer cell mediated cytotoxicity     100922500 (CASP3)    04657 IL-17 signaling pathway     100922500 (CASP3)   09156 Nervous system    04726 Serotonergic synapse     100922500 (CASP3)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100922500 (CASP3)    05206 MicroRNAs in cancer     100922500 (CASP3)    05205 Proteoglycans in cancer     100922500 (CASP3)    05203 Viral carcinogenesis     100922500 (CASP3)   09162 Cancer: specific types    05210 Colorectal cancer     100922500 (CASP3)    05222 Small cell lung cancer     100922500 (CASP3)   09164 Neurodegenerative disease    05010 Alzheimer disease     100922500 (CASP3)    05012 Parkinson disease     100922500 (CASP3)    05014 Amyotrophic lateral sclerosis     100922500 (CASP3)    05016 Huntington disease     100922500 (CASP3)    05020 Prion disease     100922500 (CASP3)    05022 Pathways of neurodegeneration - multiple diseases     100922500 (CASP3)   09166 Cardiovascular disease    05416 Viral myocarditis     100922500 (CASP3)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     100922500 (CASP3)    04933 AGE-RAGE signaling pathway in diabetic complications     100922500 (CASP3)   09171 Infectious disease: bacterial    05132 Salmonella infection     100922500 (CASP3)    05133 Pertussis     100922500 (CASP3)    05134 Legionellosis     100922500 (CASP3)    05152 Tuberculosis     100922500 (CASP3)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     100922500 (CASP3)    05161 Hepatitis B     100922500 (CASP3)    05160 Hepatitis C     100922500 (CASP3)    05164 Influenza A     100922500 (CASP3)    05162 Measles     100922500 (CASP3)    05168 Herpes simplex virus 1 infection     100922500 (CASP3)    05163 Human cytomegalovirus infection     100922500 (CASP3)    05167 Kaposi sarcoma-associated herpesvirus infection     100922500 (CASP3)    05169 Epstein-Barr virus infection     100922500 (CASP3)    05165 Human papillomavirus infection     100922500 (CASP3)   09174 Infectious disease: parasitic    05146 Amoebiasis     100922500 (CASP3)    05145 Toxoplasmosis     100922500 (CASP3)   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     100922500 (CASP3)  09180 Brite Hierarchies   09181 Protein families: metabolism    01002 Peptidases and inhibitors [BR:shr01002]     100922500 (CASP3) Enzymes [BR:shr01000]  3. Hydrolases   3.4  Acting on peptide bonds (peptidases)    3.4.22  Cysteine endopeptidases     3.4.22.56  caspase-3      100922500 (CASP3) Peptidases and inhibitors [BR:shr01002]  Cysteine peptidases   Family C14: caspase family    100922500 (CASP3) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Peptidase_C14 Motif Other DBs NCBI-GeneID:  100922500 NCBI-ProteinID:  XP_003773079 Ensembl:  ENSSHAG00000009178 UniProt:  G3W5D0 LinkDB All DBs Position 6 AA seq 275 aa AA seqDB search MENTEITIDSKSSKSSGLKIFHGSKSVESGLSSDSYKMDYPEMGLCVIINNKNFHPNTGM SFRSGTDVDAAHLRDTFKSLKYEVRNKNDLTCKEIIELLYNVSKEDHSQRSSFVCVILSH GEEGIIFGTDGSVELKRLTYFFKGDKCKSLTGKPKLFIIQACRGTELDCGIETDSATDDV TCQKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAVLKQYAYKLEIMQILTRVNRK VATEFESYSLDATFHAKKQVPCIMSMLTKELYFFP NT seq 828 nt NT seq  +upstreamnt  +downstreamnt atggaaaatactgaaattacaatagattcaaagtcctccaaaagttcaggattaaagatc ttccatggtagcaagtctgtggaatctggactgtcatcagacagctataaaatggattat ccagaaatggggttatgtgtaatcataaataataaaaattttcacccaaacactggcatg tcttttcggtctgggactgatgtagatgcagcacatctcagggatacattcaaaagcttg aaatatgaagtcagaaataaaaatgatttgacatgtaaagaaataattgaattactttac aatgtttctaaagaagatcacagccaaaggagcagttttgtttgtgtgattctaagtcat ggtgaagaaggaatcatctttgggacagatggatctgttgaactgaaaagattaacatat ttctttaaaggggataagtgtaaaagtcttacaggaaaaccaaagctttttatcattcag gcatgtagaggcacagagttggattgtggtattgagacagatagtgccactgatgatgta acatgccagaaaatacctgttgaggcagacttcttatatgcttattctacagccccaggt tactattcttggagaaattcaaaggatggttcatggtttatccagtcactttgtgcagtg ctgaaacagtatgcttacaagcttgaaatcatgcaaatccttaccagagtcaatcggaag gttgccacagagtttgaatcttactccttagatgctaccttccatgcaaagaaacaggtg ccatgtatcatgtccatgcttactaaggaactatattttttcccctaa

Sarcophilus harrisii (Tasmanian devil): 100922757 Help Entry 100922757         CDS       T02286                                  Definition (RefSeq) caspase-3-like   KO K02187   caspase 3 [EC:3.4.22.56] Organism shr  Sarcophilus harrisii (Tasmanian devil) Pathway shr01524   Platinum drug resistance shr04010   MAPK signaling pathway shr04115   p53 signaling pathway shr04210   Apoptosis shr04215   Apoptosis - multiple species shr04650   Natural killer cell mediated cytotoxicity shr04657   IL-17 signaling pathway shr04668   TNF signaling pathway shr04726   Serotonergic synapse shr04932   Non-alcoholic fatty liver disease shr04933   AGE-RAGE signaling pathway in diabetic complications shr05010   Alzheimer disease shr05012   Parkinson disease shr05014   Amyotrophic lateral sclerosis shr05016   Huntington disease shr05020   Prion disease shr05022   Pathways of neurodegeneration - multiple diseases shr05132   Salmonella infection shr05133   Pertussis shr05134   Legionellosis shr05145   Toxoplasmosis shr05146   Amoebiasis shr05152   Tuberculosis shr05160   Hepatitis C shr05161   Hepatitis B shr05162   Measles shr05163   Human cytomegalovirus infection shr05164   Influenza A shr05165   Human papillomavirus infection shr05167   Kaposi sarcoma-associated herpesvirus infection shr05168   Herpes simplex virus 1 infection shr05169   Epstein-Barr virus infection shr05170   Human immunodeficiency virus 1 infection shr05200   Pathways in cancer shr05203   Viral carcinogenesis shr05205   Proteoglycans in cancer shr05206   MicroRNAs in cancer shr05210   Colorectal cancer shr05222   Small cell lung cancer shr05416   Viral myocarditis Brite KEGG Orthology (KO) [BR:shr00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     100922757    04668 TNF signaling pathway     100922757  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     100922757    04215 Apoptosis - multiple species     100922757    04115 p53 signaling pathway     100922757  09150 Organismal Systems   09151 Immune system    04650 Natural killer cell mediated cytotoxicity     100922757    04657 IL-17 signaling pathway     100922757   09156 Nervous system    04726 Serotonergic synapse     100922757  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100922757    05206 MicroRNAs in cancer     100922757    05205 Proteoglycans in cancer     100922757    05203 Viral carcinogenesis     100922757   09162 Cancer: specific types    05210 Colorectal cancer     100922757    05222 Small cell lung cancer     100922757   09164 Neurodegenerative disease    05010 Alzheimer disease     100922757    05012 Parkinson disease     100922757    05014 Amyotrophic lateral sclerosis     100922757    05016 Huntington disease     100922757    05020 Prion disease     100922757    05022 Pathways of neurodegeneration - multiple diseases     100922757   09166 Cardiovascular disease    05416 Viral myocarditis     100922757   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     100922757    04933 AGE-RAGE signaling pathway in diabetic complications     100922757   09171 Infectious disease: bacterial    05132 Salmonella infection     100922757    05133 Pertussis     100922757    05134 Legionellosis     100922757    05152 Tuberculosis     100922757   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     100922757    05161 Hepatitis B     100922757    05160 Hepatitis C     100922757    05164 Influenza A     100922757    05162 Measles     100922757    05168 Herpes simplex virus 1 infection     100922757    05163 Human cytomegalovirus infection     100922757    05167 Kaposi sarcoma-associated herpesvirus infection     100922757    05169 Epstein-Barr virus infection     100922757    05165 Human papillomavirus infection     100922757   09174 Infectious disease: parasitic    05146 Amoebiasis     100922757    05145 Toxoplasmosis     100922757   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     100922757  09180 Brite Hierarchies   09181 Protein families: metabolism    01002 Peptidases and inhibitors [BR:shr01002]     100922757 Enzymes [BR:shr01000]  3. Hydrolases   3.4  Acting on peptide bonds (peptidases)    3.4.22  Cysteine endopeptidases     3.4.22.56  caspase-3      100922757 Peptidases and inhibitors [BR:shr01002]  Cysteine peptidases   Family C14: caspase family    100922757 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Peptidase_C14 Motif Other DBs NCBI-GeneID:  100922757 NCBI-ProteinID:  XP_003773080 Ensembl:  ENSSHAG00000009402 LinkDB All DBs Position 6 AA seq 303 aa AA seqDB search MLRCSVGGSGLGYFSTLVERSTMENTEITVDSKSTQNSGVKIFHASKSVESSLSSDSYKM DYPEMGLCVIINNKNFHQNTGMSFRSGTDVDEAHLIDTFKHLKYEIRNKNDLTCKEITEL MYNVSKEDHSQRSSFVCVILSHGKEGIIYGKDGPVELKALTCFFKGDKCNSLIGKPKLFI VQACRGTELDCGVEVDSGPDDNDTDEDITCQKIPVEADFLYAYSTAPGYFSWRNEKDGSW FIQSLCAVLKQYAHKLEIMQILTRVNWKVATEFESYSLDATFHAKKQVPCIMSMLTKELY FFP NT seq 912 nt NT seq  +upstreamnt  +downstreamnt atgctgcggtgcagcgtaggcggatctgggcttggctacttctctacgttagttgagaga agcaccatggaaaatactgaaattacagtagattcaaaatctactcaaaattcaggagta aagatcttccatgctagcaagtctgtggaatctagtctgtcatcagatagctataaaatg gattatccagaaatgggattgtgtgtaatcatcaataataaaaattttcaccaaaacact ggcatgtcatttcgatctggtacagatgtagacgaagcacatctcatagatactttcaag cacttgaaatatgaaatcaggaataaaaatgatctgacatgcaaagaaattactgaatta atgtacaatgtttctaaagaagatcacagccaacgaagcagttttgtttgtgtgattcta agtcatggtaaagaaggaatcatttatggcaaggatggacctgttgaactgaaagcatta acatgtttcttcaaaggggataaatgtaacagtctaataggaaaaccaaagctttttatt gttcaggcatgtagaggcacagagttggattgtggtgttgaggtagacagtggccctgat gacaatgacactgatgaggacataacatgccagaaaatacctgttgaggcagacttcttg tatgcatattctacagccccaggttacttttcttggagaaatgaaaaggatggttcatgg tttatccaatcactttgtgcagtgctgaaacaatatgctcacaagcttgaaatcatgcaa atccttaccagagtcaattggaaggtcgccacagagtttgaatcttactccttagatgct accttccatgcaaagaagcaggtgccatgtatcatgtccatgcttactaaggaactatat tttttcccctaa

DBGET integrated database retrieval system