KEGG   Sarcophilus harrisii (Tasmanian devil): 100922609
Entry
100922609         CDS       T02286                                 

Gene name
TCF7L1
Definition
(RefSeq) transcription factor 7-like 1
  KO
K04490  transcription factor 7-like 1
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr04310  Wnt signaling pathway
shr04390  Hippo signaling pathway
shr04520  Adherens junction
shr04916  Melanogenesis
shr04934  Cushing syndrome
shr05132  Salmonella infection
shr05165  Human papillomavirus infection
shr05167  Kaposi sarcoma-associated herpesvirus infection
shr05200  Pathways in cancer
shr05210  Colorectal cancer
shr05213  Endometrial cancer
shr05215  Prostate cancer
shr05216  Thyroid cancer
shr05217  Basal cell carcinoma
shr05221  Acute myeloid leukemia
shr05224  Breast cancer
shr05225  Hepatocellular carcinoma
shr05226  Gastric cancer
shr05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:shr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100922609 (TCF7L1)
   04390 Hippo signaling pathway
    100922609 (TCF7L1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    100922609 (TCF7L1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100922609 (TCF7L1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100922609 (TCF7L1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100922609 (TCF7L1)
   05225 Hepatocellular carcinoma
    100922609 (TCF7L1)
   05226 Gastric cancer
    100922609 (TCF7L1)
   05216 Thyroid cancer
    100922609 (TCF7L1)
   05221 Acute myeloid leukemia
    100922609 (TCF7L1)
   05217 Basal cell carcinoma
    100922609 (TCF7L1)
   05215 Prostate cancer
    100922609 (TCF7L1)
   05213 Endometrial cancer
    100922609 (TCF7L1)
   05224 Breast cancer
    100922609 (TCF7L1)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100922609 (TCF7L1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100922609 (TCF7L1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100922609 (TCF7L1)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    100922609 (TCF7L1)
   05165 Human papillomavirus infection
    100922609 (TCF7L1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:shr03000]
    100922609 (TCF7L1)
Transcription factors [BR:shr03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG TCF-1
    100922609 (TCF7L1)
SSDB
Motif
Pfam: CTNNB1_binding HMG_box HMG_box_2
Other DBs
NCBI-GeneID: 100922609
NCBI-ProteinID: XP_031805625
Ensembl: ENSSHAG00000006659
LinkDB
Position
2
AA seq 589 aa
MPQLGGGGGGSGSGGSGGGAGAGAGGGGGGGGSGGDDLGANDELITFQDEGSEEQEPSSD
SASAQRDLDEVKSSLVNESENQSSSSDSEAERRPQPPRDPFQKPREYFAEVRRPQDGAFF
KGPPYPGYPLLMIPDLSSPYLPNGPLSPSGARTYLQMKWPLIDVPSSTTVKDTRSPSPAH
LSNKVPVVQHPHHMHPLTPLITYSNDHFSPGSPPAHLSPEIDPKTGIPRPPHPAELSPYY
PLSPGAVGQIPHPLGWLVPQQGQPMYSIPPGGFRHPYPALAMNASMSSLVSSRFSPHMVA
PSHHGLPTSGIPHPAIVSPIVKQEPTPPTMSPSVSAKSPVTVKKEEEKKPHVKKPLNAFM
LYMKEMRAKVVAECTLKESAAINQILGRRWHSLSREEQAKYYELARKERQLHSQLYPTWS
ARDNYGKKKKRKREKQLSQPPPQPQPQVQEAESALASRNKKPCLHYAPPEKPCDSPASSH
GSMLDSPATPSAALASPAAPAATHSEQAQPLSLTTKPEARAQLALHSAAFLSAKAAAAAS
PLGSQPPLLSRPLPLSSMPTTLLTSPPSFQAPLHALQAQPLSLVTKPAH
NT seq 1770 nt   +upstreamnt  +downstreamnt
atgccccagctcggcggcggcggcggcggtagcggcagcgggggcagcggcgggggagca
ggagccggagccggcggcggcggcggcggcgggggcagcggcggcgatgacctcggggcc
aacgacgagctcatcacctttcaggacgagggcagcgaggagcaagagccgagcagcgac
agcgcctcggcccagcgggacctggacgaggtcaagtcctcgctggtcaacgagtcggag
aaccagagcagtagctcggactccgaggcggagcggcgcccgcagcccccccgggaccct
ttccagaagccgcgggaatacttcgctgaagtgaggaggccccaggatggcgctttcttt
aagggacctccttaccccggctaccccttactgatgatcccagatctgagcagcccctac
ctccccaacggacccctgtcccccagcggcgcccgcacgtacctgcagatgaaatggccc
ctcatcgatgtcccatcaagcaccacagtgaaggacacaaggtcaccatcccctgcacac
ttgtccaacaaagttcccgtggtccagcaccctcaccatatgcaccccctgactcccctc
atcacctacagcaatgaccacttttcccctggctccccaccggcacacctctccccggag
atcgatccaaagacaggaatccccaggccacctcatcctgctgagctgtcaccttattac
ccgctgtctcctggagctgttggtcagatcccccatccactgggctggctcgtcccacag
caaggacaaccaatgtactccatccctcccggcggcttccggcacccatacccagccctt
gccatgaatgcttcaatgtccagtttggtttccagtcgcttctctccacacatggtggcc
ccttcccaccatggtctgcccacatcagggatcccccatccggccattgtctcacccatc
gtcaaacaggagcccacaccccccaccatgagcccatccgtaagcgcgaaatccccagtg
acggtgaaaaaggaggaagagaagaagccccatgtgaagaagcctctcaatgccttcatg
ttgtatatgaaggagatgagggccaaggtggtcgccgagtgtacgctgaaagagagcgca
gctatcaaccagatcctaggaagaaggtggcattcgctctcgagggaagaacaggccaag
tactacgagctggcccgcaaagagaggcagcttcactcccagctctatcccacctggtca
gcgcgggacaactatggcaagaagaagaagagaaaacgtgagaagcagctgtcacagcct
ccaccgcagccgcagccgcaagttcaagaggctgaaagcgccctggcctccaggaacaag
aagccgtgtctacactacgcgccaccggagaagccttgcgacagccccgcctcctcccac
gggagcatgctggactccccagccaccccctccgctgcgctggcctccccagccgccccg
gcagccactcactcggagcaagcgcagccgctgtccctcaccaccaagcccgaggcccgg
gcccagctggccctccactccgccgccttcctgtccgccaaggcggccgccgccgccagc
cccctgggcagccagccccccctcctctcccggcccctccccctcagctccatgcccacc
actctgttgacttcccccccttctttccaggctcccctccatgccctgcaggcccagccc
ctctccttggtcaccaaacctgctcactaa

DBGET integrated database retrieval system