KEGG   Sarcophilus harrisii (Tasmanian devil): 100922675
Entry
100922675         CDS       T02286                                 

Gene name
TCF7L2
Definition
(RefSeq) transcription factor 7-like 2 isoform X11
  KO
K04491  transcription factor 7-like 2
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr04310  Wnt signaling pathway
shr04390  Hippo signaling pathway
shr04520  Adherens junction
shr04916  Melanogenesis
shr04934  Cushing syndrome
shr05132  Salmonella infection
shr05165  Human papillomavirus infection
shr05167  Kaposi sarcoma-associated herpesvirus infection
shr05200  Pathways in cancer
shr05210  Colorectal cancer
shr05213  Endometrial cancer
shr05215  Prostate cancer
shr05216  Thyroid cancer
shr05217  Basal cell carcinoma
shr05221  Acute myeloid leukemia
shr05224  Breast cancer
shr05225  Hepatocellular carcinoma
shr05226  Gastric cancer
shr05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:shr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100922675 (TCF7L2)
   04390 Hippo signaling pathway
    100922675 (TCF7L2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    100922675 (TCF7L2)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100922675 (TCF7L2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100922675 (TCF7L2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100922675 (TCF7L2)
   05225 Hepatocellular carcinoma
    100922675 (TCF7L2)
   05226 Gastric cancer
    100922675 (TCF7L2)
   05216 Thyroid cancer
    100922675 (TCF7L2)
   05221 Acute myeloid leukemia
    100922675 (TCF7L2)
   05217 Basal cell carcinoma
    100922675 (TCF7L2)
   05215 Prostate cancer
    100922675 (TCF7L2)
   05213 Endometrial cancer
    100922675 (TCF7L2)
   05224 Breast cancer
    100922675 (TCF7L2)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100922675 (TCF7L2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100922675 (TCF7L2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100922675 (TCF7L2)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    100922675 (TCF7L2)
   05165 Human papillomavirus infection
    100922675 (TCF7L2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:shr03000]
    100922675 (TCF7L2)
Transcription factors [BR:shr03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG TCF-1
    100922675 (TCF7L2)
SSDB
Motif
Pfam: CTNNB1_binding HMG_box HMG_box_2
Other DBs
NCBI-GeneID: 100922675
NCBI-ProteinID: XP_003755406
Ensembl: ENSSHAG00000017344
LinkDB
Position
2
AA seq 605 aa
MPQLNGGGGDDLGANDELISFKDEGEQEEKISENSSAERDLADVKSSLVNESETNQNSSS
DSEAERRPPPRSESFRDKSRESLEEAAKRQDGGLFKGPPYPGYPFIMIPDLTSPYLPNGS
LSPTARTYLQMKWPLLDVQAGSLQSRQALKDARSPSPAHIVSNKVPVVQHPHHVHPLTPL
ITYSNEHFTPGNPPPHLPADVDPKTGIPRPPHPPDISPYYPLSPGTVGQIPHPLGWLVPQ
QGQPVYPITTGGFRHPYPTALTVNASMSRFPPHMVPPHHTLHTTGIPHPAIVTPTVKQES
SQSDVASLHSSKHQDSKKEEEKKKPHIKKPLNAFMLYMKEMRAKVVAECTLKESAAINQI
LGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKKKRKRDKQPGETNEHSE
CFLNPCLSLPPITDLSAPKKCRARFGLDQQNNWCGPCRRKKKCVRYIQGEGSCLSPPSSD
GSLLDSPPSSPNMLGSPTRDSKPQTEQTQPLSLTLKPDSLAHLAMMPPPPPSLLLAESAH
SKPGALAVTAAHCPNGALDLPPSALQPPAAPSSSLAQPSTSSLHSHNSLAGTQPQPLSLV
TKSLE
NT seq 1818 nt   +upstreamnt  +downstreamnt
atgccgcagctgaacggcggtggaggagatgacctaggcgccaacgatgagctgatctcc
ttcaaagacgaaggggagcaggaggaaaaaatctcggagaactcctcggccgagagggat
ttagctgatgtcaaatcgtccctagtcaatgaatcagaaacgaatcaaaacagctcctca
gattccgaggcggaaagacggcccccgcctcgatccgaaagtttcagagataaatccaga
gaaagtttagaagaagccgcgaagaggcaagatggagggttgtttaaggggccaccgtac
cctggttatcccttcattatgatacccgacttgactagcccgtacctccccaatggatcc
ctctctccgacggcaagaacatatctccagatgaaatggccactgcttgatgttcaagca
gggagcttacagagtagacaagctctcaaggatgcaaggtctccgtctccagcacacatc
gtttctaacaaagtgcccgttgtgcagcaccctcaccatgtacaccctcttacgccgctt
atcacatacagcaatgagcacttcaccccaggaaacccacctccacacttaccagccgac
gtagatcccaaaacaggaattccacgacctccacatcctccggatatatctccttattac
ccactatcgcctggcaccgtaggacaaatcccccatccgctaggatggttagtaccacag
caaggtcaaccagtttacccaatcacaacaggaggattcaggcatccttatccaacagct
ctgactgtcaatgcttccatgtcaaggtttcctcctcatatggtcccaccacatcatact
ttacacacaactggaattcctcatccagccatagtcacaccaacagtcaaacaggaatct
tcccagagtgatgttgcctcactccatagctcgaaacatcaggactccaaaaaagaagaa
gaaaagaaaaaaccccacataaagaaacctcttaatgcattcatgttgtatatgaaggaa
atgagagcaaaagttgtagcagaatgtacattgaaagaaagcgcagccatcaaccagatt
cttggtcgaaggtggcacgcgttatccagagaagagcaagccaagtactacgagctcgcc
aggaaggagcgacagcttcacatgcagctttatccaggctggtccgctcgagataactat
ggaaagaagaagaagaggaaaagggacaagcagccaggagagactaatgaacacagcgaa
tgtttcctaaatccttgcctttcacttcctccgattacagacctgagcgctcctaagaaa
tgccgagcgcgctttggccttgatcaacagaataactggtgcggtccctgcaggagaaaa
aaaaagtgcgttcgctacatacaaggtgaaggcagctgcctcagtccaccctcttcagat
ggaagcttattagactcccctccttcttctcctaacatgctaggctcccctaccagagac
tccaaaccacagactgaacaaacccaacctctctcgcttacattgaaacccgactccctg
gcccacctggccatgatgccgccgccgccaccctctctcctcctggccgagagtgcccac
agcaagcccggcgccttggctgtcaccgctgcccactgtccgaacggggctctggacctg
ccaccttccgctctgcagccgccggctgccccctcatcgtctctagcacagccgtcgaca
tcttctttacattcccacaattctttggctgggacccagccccagccgctctcccttgta
accaagtctttagaatag

DBGET integrated database retrieval system