KEGG   Sarcophilus harrisii (Tasmanian devil): 100922964Help
Entry
100922964         CDS       T02286                                 

Gene name
CNDP1
Definition
(RefSeq) beta-Ala-His dipeptidase
  KO
K05604  beta-Ala-His dipeptidase [EC:3.4.13.20]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr00330  Arginine and proline metabolism
shr00340  Histidine metabolism
shr00410  beta-Alanine metabolism
shr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:shr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    100922964 (CNDP1)
   00340 Histidine metabolism
    100922964 (CNDP1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100922964 (CNDP1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:shr01002]
    100922964 (CNDP1)
Enzymes [BR:shr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.13  Dipeptidases
    3.4.13.20  beta-Ala-His dipeptidase
     100922964 (CNDP1)
Peptidases and inhibitors [BR:shr01002]
 Metallo peptidases
  Family M20
   100922964 (CNDP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M20 M20_dimer WG_beta_rep Peptidase_M28
Motif
Other DBs
NCBI-GeneID: 100922964
NCBI-ProteinID: XP_023352048
Ensembl: ENSSHAG00000009859
LinkDB All DBs
Position
2
AA seq 533 aa AA seqDB search
MLPAFILAPFPFAVQGHCFRAQTSFQMDPKLKRMASSIFTLLLLLEGGLFSSSSPSSSGM
LENIFQYIDLHQNEFIQLLKEWVAIESDSVQPLPHFRQEIFKMMDIAADKLRHLGASVDL
IEMGPQQLPDGQTLPIPPILLAELGNDPKKPTVCFYGHLDVQPAKKEDGWNTDPFTLVEV
DGKLYGRGTTDNKGPVLAWINAVVAFKALNQDIPVNIKFIIEGMEEAGSISLDELVRREK
DRFFSSVDYIVMSDNLWISKKPALTYGTRGNIYFTVEVKCRDQDFHSGTFGGILNEPMAD
LVSLLGSLVDSSGHILIPGIYDNVAPLSEEEKKMYETIDLNLEEYQNSSQVEKFLFDTKE
EILMHLWRYPSLSIHGIEGAFDEPGAKTVIPAQVTGKFSIRLVPHMNISVVETQVKKHLE
DIFSQRNSSNKLKITMILGVHPWIANIHDLQYVAARRAIKTVFGVDPDMIRDGSTIPIAK
TFQDIIQKSVMMLPLGAVDDGEHSQNEKINRYNYIEGSKLFAAFFLEIAKMHS
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgcttcctgctttcattcttgctccttttccctttgcagttcaaggtcactgtttcagg
gctcagaccagcttccaaatggatcccaaactaaaaagaatggcctcctccatcttcaca
ttactgctccttcttgaaggagggttattctcctcgtcctccccttcttcctctggaatg
ttagagaatatctttcagtacattgatcttcatcaaaatgaatttattcagttgcttaag
gagtgggtggccattgagagtgattctgttcaacccctgcctcacttcagacaagaaatc
ttcaaaatgatggacatagctgcagataagcttcggcacttaggagcctctgtagattta
atagaaatgggacctcaacagctacctgatggtcagacccttccaatacctcctattctt
ctagctgaacttggtaatgatccaaagaaacccacagtgtgtttttatggtcatttggat
gttcagcctgccaaaaaagaggatggatggaatacagaccctttcaccctggtagaagtt
gatggaaaactttatggacgaggaacaacagacaacaaaggacctgttttagcttggatt
aatgcagtggttgccttcaaagccctaaaccaagatatcccagtgaatattaaattcatt
attgaaggaatggaagaagcaggttcaatttcattagatgagcttgtcagaagagaaaaa
gaccgtttcttctccagtgttgactacattgtcatgtcagacaacctgtggattagcaag
aagccggcactcacctatggaacccgaggaaacatttacttcactgtggaggtgaaatgc
agggatcaagattttcattcaggaacttttgggggcatcctcaatgagccaatggctgat
ttggtttcccttcttggaagcctggtagattcttcaggtcatattctgatccctggaatc
tatgataatgtggctcccctttcagaagaggaaaagaagatgtatgaaactattgactta
aacctagaagaatatcaaaatagtagccaagtggaaaaattcctatttgacactaaggag
gaaatcctcatgcacctgtggcgctacccatctctttctatccatgggattgaaggagca
tttgatgaaccaggagctaaaacagtcatacctgcccaagtaacaggaaaattttcaatc
cgtttagtgcctcatatgaatatttctgttgtggagacacaggtgaaaaagcaccttgag
gatatattctctcagcgtaatagttccaacaaattgaaaatcactatgatactgggagtc
catccatggattgctaatattcatgatcttcagtatgtggctgcaagaagagcaattaaa
acagtgtttggagtagatcctgatatgataagagatggatcaactattccaattgctaaa
acattccaggatattatccaaaagagtgtgatgatgctaccactaggagcagttgatgat
ggagaacactctcagaatgagaaaataaacaggtacaactatatagagggatccaaattg
tttgcagcatttttcctggagattgctaaaatgcattcataa

DBGET integrated database retrieval system