KEGG   Sarcophilus harrisii (Tasmanian devil): 100923199
Entry
100923199         CDS       T02286                                 

Gene name
BAD
Definition
(RefSeq) bcl2-associated agonist of cell death isoform X1
  KO
K02158  Bcl-2-antagonist of cell death
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr01521  EGFR tyrosine kinase inhibitor resistance
shr01522  Endocrine resistance
shr01524  Platinum drug resistance
shr04012  ErbB signaling pathway
shr04014  Ras signaling pathway
shr04022  cGMP-PKG signaling pathway
shr04024  cAMP signaling pathway
shr04062  Chemokine signaling pathway
shr04140  Autophagy - animal
shr04151  PI3K-Akt signaling pathway
shr04210  Apoptosis
shr04370  VEGF signaling pathway
shr04510  Focal adhesion
shr04722  Neurotrophin signaling pathway
shr04910  Insulin signaling pathway
shr04919  Thyroid hormone signaling pathway
shr05010  Alzheimer disease
shr05014  Amyotrophic lateral sclerosis
shr05020  Prion disease
shr05022  Pathways of neurodegeneration - multiple diseases
shr05145  Toxoplasmosis
shr05152  Tuberculosis
shr05160  Hepatitis C
shr05161  Hepatitis B
shr05162  Measles
shr05165  Human papillomavirus infection
shr05168  Herpes simplex virus 1 infection
shr05170  Human immunodeficiency virus 1 infection
shr05200  Pathways in cancer
shr05203  Viral carcinogenesis
shr05210  Colorectal cancer
shr05211  Renal cell carcinoma
shr05212  Pancreatic cancer
shr05213  Endometrial cancer
shr05215  Prostate cancer
shr05218  Melanoma
shr05220  Chronic myeloid leukemia
shr05221  Acute myeloid leukemia
shr05223  Non-small cell lung cancer
shr05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:shr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100923199 (BAD)
   04014 Ras signaling pathway
    100923199 (BAD)
   04370 VEGF signaling pathway
    100923199 (BAD)
   04024 cAMP signaling pathway
    100923199 (BAD)
   04022 cGMP-PKG signaling pathway
    100923199 (BAD)
   04151 PI3K-Akt signaling pathway
    100923199 (BAD)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100923199 (BAD)
  09143 Cell growth and death
   04210 Apoptosis
    100923199 (BAD)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100923199 (BAD)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    100923199 (BAD)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100923199 (BAD)
   04919 Thyroid hormone signaling pathway
    100923199 (BAD)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100923199 (BAD)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100923199 (BAD)
   05203 Viral carcinogenesis
    100923199 (BAD)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100923199 (BAD)
   05212 Pancreatic cancer
    100923199 (BAD)
   05225 Hepatocellular carcinoma
    100923199 (BAD)
   05221 Acute myeloid leukemia
    100923199 (BAD)
   05220 Chronic myeloid leukemia
    100923199 (BAD)
   05218 Melanoma
    100923199 (BAD)
   05211 Renal cell carcinoma
    100923199 (BAD)
   05215 Prostate cancer
    100923199 (BAD)
   05213 Endometrial cancer
    100923199 (BAD)
   05223 Non-small cell lung cancer
    100923199 (BAD)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100923199 (BAD)
   05161 Hepatitis B
    100923199 (BAD)
   05160 Hepatitis C
    100923199 (BAD)
   05162 Measles
    100923199 (BAD)
   05168 Herpes simplex virus 1 infection
    100923199 (BAD)
   05165 Human papillomavirus infection
    100923199 (BAD)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100923199 (BAD)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100923199 (BAD)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100923199 (BAD)
   05014 Amyotrophic lateral sclerosis
    100923199 (BAD)
   05020 Prion disease
    100923199 (BAD)
   05022 Pathways of neurodegeneration - multiple diseases
    100923199 (BAD)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100923199 (BAD)
   01524 Platinum drug resistance
    100923199 (BAD)
   01522 Endocrine resistance
    100923199 (BAD)
SSDB
Motif
Pfam: Bcl-2_BAD
Other DBs
NCBI-GeneID: 100923199
NCBI-ProteinID: XP_012408299
Ensembl: ENSSHAG00000005178
LinkDB
Position
6
AA seq 301 aa
MESAAGAAGPIPPPSLSFSLRLMGKLGLAPPPPGAAGGAGLFRGGSPLCRRRLQPSPSPD
PGAPPGPRSGRWTRVTWPRGGGERPQLLPGCRKVWPSLTGQTFIRHLLSARPPSGNTQRE
PQGAPGVPGDGLLTRPKDASHPVSMFQISEFEPSEPGEDPSASTAPSLAPLRPGPRAAPG
AHHHEGAGAGRPRLISYPPLREGSREASPEAEAEAEQSEGEEERGLFRGRSSSAPPILWA
ARHYGSELRRMSDEFHCTFKGLPRPKSAGTASQMRRSHGWTRTFQSWFGRNLGKGSVGPS
H
NT seq 906 nt   +upstreamnt  +downstreamnt
atggagagcgctgcaggcgcagccggcccgatcccgccgcccagcctcagtttctccctc
cgtttaatggggaagttaggcttggcccctccccctcccggggccgctgggggggccggg
ctgttccggggtggaagccccctctgccggcgtagattgcagcccagcccttccccggat
cccggggcgccccctggaccacgctcggggcgctggactcgagttacctggccccgaggt
ggtggggagaggccgcagctcctcccgggctgcaggaaggtgtggccttccctgaccggt
cagacatttattagacacctgctgagtgccaggcctccatccgggaacacacagagagag
cctcagggagccccaggagtgccaggtgatgggctattgactaggccgaaggatgcctcc
caccctgtgagcatgttccagatatccgagtttgagcccagtgagcccggagaagaccct
tctgcctccactgcccccagcctcgccccgctcaggccaggaccccgagcagcacctgga
gcccaccaccatgagggcgccggcgcggggaggcctcgcctgatctcctaccccccgcta
agggagggctcccgggaggcgagccccgaagcggaggccgaggcagagcagtccgagggg
gaggaagagcgcggcctcttccggggccgctccagctcagcgccccctatcctctgggcg
gcgcggcattatggcagcgagctgcgcaggatgagcgacgagttccactgcaccttcaag
ggacttccccgcccgaagagcgcaggcactgcgagccagatgcgtcggagccatggctgg
acccgcaccttccagtcttggttcgggcggaatttggggaaagggagcgtcggtccttcc
cactga

DBGET integrated database retrieval system