KEGG   Sarcophilus harrisii (Tasmanian devil): 100923337Help
Entry
100923337         CDS       T02286                                 

Gene name
PARK7
Definition
(RefSeq) protein/nucleic acid deglycase DJ-1
  KO
K05687  protein DJ-1 [EC:3.5.1.124]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr05012  Parkinson's disease
Brite
KEGG Orthology (KO) [BR:shr00001]
 Human Diseases
  Neurodegenerative diseases
   05012 Parkinson's disease
    100923337 (PARK7)
Enzymes [BR:shr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.124  protein deglycase
     100923337 (PARK7)
Peptidases [BR:shr01002]
 Cysteine Peptidases
  Family C56: PfpI endopeptidase family
   100923337 (PARK7)
Exosome [BR:shr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100923337 (PARK7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DJ-1_PfpI ThiJ_like GATase_3
Motif
Other DBs
NCBI-GeneID: 100923337
NCBI-ProteinID: XP_003765254
LinkDB All DBs
Position
3
AA seq 187 aa AA seqDB search
MAAKKALVILAKGAEEMETVIPVDLMRRAGMKVIVAGLSGKDPVQCSRDVLICPDASLED
ATKEAPYDVIVLPGGNLGAQNLRESPQVKTLLKEQEKRKGLIAAICAGPTALLAHEISFG
SKVTTHPGAKDKMMDGNHYTYTENRVEKDGIILTSRGPGTSFEFGLAIIAELMGKEVADQ
VKAPLIL
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atggctgcaaaaaaagcattagtcattctggcaaaaggagcagaggagatggaaacagtt
atccctgttgatttaatgaggagggctggaatgaaagtcatcgttgcaggtctttctgga
aaggatccagtacagtgtagtagagatgtgctcatttgccccgatgccagtctagaagat
gcaacaaaggaggcaccatatgatgtgatagtcctgccaggaggtaatctgggtgcacag
aatttgagagagagtccacaagtgaagacactgctgaaagaacaagagaaaagaaaaggc
cttattgctgccatttgtgcaggacctacagctctcttggctcatgaaataagttttgga
agcaaagttacaacccaccctggggccaaagacaagatgatggatggaaatcattatacc
tacacagagaatcgtgtggaaaaggatggcatcattcttacaagccgtggtcctggaacc
agctttgagtttgggcttgcaattattgcagaactgatgggaaaagaagtagcagatcaa
gtgaaggctcctcttattctttaa

DBGET integrated database retrieval system