KEGG   Sarcophilus harrisii (Tasmanian devil): 100923569
Entry
100923569         CDS       T02286                                 

Gene name
SMAD4
Definition
(RefSeq) mothers against decapentaplegic homolog 4
  KO
K04501  mothers against decapentaplegic homolog 4
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr04068  FoxO signaling pathway
shr04110  Cell cycle
shr04310  Wnt signaling pathway
shr04350  TGF-beta signaling pathway
shr04371  Apelin signaling pathway
shr04390  Hippo signaling pathway
shr04520  Adherens junction
shr04550  Signaling pathways regulating pluripotency of stem cells
shr04659  Th17 cell differentiation
shr04933  AGE-RAGE signaling pathway in diabetic complications
shr05161  Hepatitis B
shr05166  Human T-cell leukemia virus 1 infection
shr05200  Pathways in cancer
shr05210  Colorectal cancer
shr05212  Pancreatic cancer
shr05220  Chronic myeloid leukemia
shr05225  Hepatocellular carcinoma
shr05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:shr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100923569 (SMAD4)
   04350 TGF-beta signaling pathway
    100923569 (SMAD4)
   04390 Hippo signaling pathway
    100923569 (SMAD4)
   04371 Apelin signaling pathway
    100923569 (SMAD4)
   04068 FoxO signaling pathway
    100923569 (SMAD4)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100923569 (SMAD4)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    100923569 (SMAD4)
   04550 Signaling pathways regulating pluripotency of stem cells
    100923569 (SMAD4)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    100923569 (SMAD4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100923569 (SMAD4)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100923569 (SMAD4)
   05212 Pancreatic cancer
    100923569 (SMAD4)
   05225 Hepatocellular carcinoma
    100923569 (SMAD4)
   05226 Gastric cancer
    100923569 (SMAD4)
   05220 Chronic myeloid leukemia
    100923569 (SMAD4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100923569 (SMAD4)
   05161 Hepatitis B
    100923569 (SMAD4)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100923569 (SMAD4)
SSDB
Motif
Pfam: MH2 MH1 IRF-3
Other DBs
NCBI-GeneID: 100923569
NCBI-ProteinID: XP_031801809
Ensembl: ENSSHAG00000010344
LinkDB
Position
1
AA seq 552 aa
MDNMSITNTPTSNDACLSIVHSLMCHRQGGESETFAKRAIESLVKKLKEKKDELDSLITA
ITTNGAHPSKCVTIQRTLDGRLQVAGRKGFPHVIYARLWRWPDLHKNELKHVKYCQYAFD
LKCDSVCVNPYHYERVVSPGIDLSGLTLQSSAPSSMLVKDEYVHDFEGQPSLSTEGHSIQ
TIQHPPSNRASSETYTNPAMLAPSESNTTSTTNFPNIPVASTSQPTSILTGSHSEGLLQI
ASGPQPGQQQNGFTAQPATYHHNSTTTWTGSRTAAYTPNIPHHQNGHLQHHPPMPPHPGH
YWPVHNEIAFQPPISNHPAPEYWCSIAYFEMDVQVGETFKVPSSCPIVTVDGYVDPSGGD
RFCLGQLSNVHRTEAIERARLHIGKGVQLECKGEGDVWVRCLSDHAVFVQSYYLDREAGR
APGDAVHKIYPSAYIKVFDLRQCHRQMQQQAATAQAAAAAQAAAVAGNIPGPGSVGGIAP
AISLSAAAGIGVDDLRRLCILRMSFVKGWGPDYPRQSIKETPCWIEIHLHRALQLLDEVL
HTMPIADPQPLD
NT seq 1659 nt   +upstreamnt  +downstreamnt
atggacaatatgtctattactaacacacccacaagtaatgatgcctgtctgagcattgtt
catagtttgatgtgccatagacaaggtggagaaagtgaaacatttgcaaaaagagcaatt
gaaagtttggtaaagaagctgaaggagaagaaggatgaattggattctttaataacagct
ataactacaaatggcgcccatcccagcaaatgtgtcacgatacagaggacattggatggc
aggcttcaggtggctggtcggaaaggtttccctcatgtgatatatgctcgtctctggagg
tggcctgatcttcacaaaaatgaacttaaacatgtgaaatactgtcagtacgcttttgat
ctaaaatgtgatagtgtctgtgtgaatccatatcattatgaaagagttgtatcgcctggc
attgatctctcaggattgacattgcaaagttctgctccatcaagtatgttggtgaaggac
gagtatgttcatgactttgagggacagccatcattgtccactgaaggacattcaattcag
accatacagcatccaccaagtaaccgtgcatcttcagagacatacaccaacccagccatg
ttagctccatctgagtctaatactaccagcaccactaactttcccaacattcctgtggct
tccacaagtcagcctaccagtatattgacaggcagccatagtgaaggacttttgcagata
gcttcaggacctcaaccaggacagcagcagaatggatttactgctcagccagctacttat
catcataacagtactaccacctggactggaagtagaactgcagcatatacgcctaatata
cctcaccaccaaaatggtcatcttcagcatcatccgcctatgccaccccatcctggacat
tactggccagttcacaatgagattgcattccaacctcccatttctaatcatcctgctcct
gaatattggtgttcaattgcttactttgaaatggatgttcaggtaggagagacatttaaa
gttccttcaagctgcccaatagttactgttgatggatatgtggacccatctggaggagac
cgcttttgcttgggtcagctctccaacgtgcacagaactgaagctattgagagagcaagg
ttacacataggcaaaggtgtgcaattggaatgtaaaggtgaaggtgatgtttgggttagg
tgcctcagtgatcatgcagtgtttgtgcagagttactacttagatcgagaggctggacga
gcaccaggagatgctgttcataaaatttatccaagtgcatatataaaggtatttgattta
cgtcagtgccatcgtcagatgcaacaacaagctgccactgcacaagctgcagcagctgct
caagccgcagcagtagcaggaaatatccccggaccaggatcagtaggtggaatagcccct
gccatcagtctgtcggcagctgctgggattggcgtggatgacctgcgccgcttatgcata
ctcaggatgagctttgtaaaaggctggggccctgactatccaaggcagagcatcaaagaa
acaccttgctggattgagattcatttacaccgtgccctccaactcctagatgaagtactt
cataccatgcctattgcagacccacagccattagattga

DBGET integrated database retrieval system