KEGG   Sarcophilus harrisii (Tasmanian devil): 100923657
Entry
100923657         CDS       T02286                                 

Gene name
POLK
Definition
(RefSeq) DNA polymerase kappa isoform X1
  KO
K03511  DNA polymerase kappa [EC:2.7.7.7]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr03460  Fanconi anemia pathway
shr05169  Epstein-Barr virus infection
shr05200  Pathways in cancer
shr05202  Transcriptional misregulation in cancer
shr05210  Colorectal cancer
shr05212  Pancreatic cancer
shr05213  Endometrial cancer
shr05214  Glioma
shr05216  Thyroid cancer
shr05217  Basal cell carcinoma
shr05218  Melanoma
shr05220  Chronic myeloid leukemia
shr05222  Small cell lung cancer
shr05223  Non-small cell lung cancer
shr05224  Breast cancer
shr05225  Hepatocellular carcinoma
shr05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:shr00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    100923657 (POLK)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100923657 (POLK)
   05202 Transcriptional misregulation in cancer
    100923657 (POLK)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100923657 (POLK)
   05212 Pancreatic cancer
    100923657 (POLK)
   05225 Hepatocellular carcinoma
    100923657 (POLK)
   05226 Gastric cancer
    100923657 (POLK)
   05214 Glioma
    100923657 (POLK)
   05216 Thyroid cancer
    100923657 (POLK)
   05220 Chronic myeloid leukemia
    100923657 (POLK)
   05217 Basal cell carcinoma
    100923657 (POLK)
   05218 Melanoma
    100923657 (POLK)
   05213 Endometrial cancer
    100923657 (POLK)
   05224 Breast cancer
    100923657 (POLK)
   05222 Small cell lung cancer
    100923657 (POLK)
   05223 Non-small cell lung cancer
    100923657 (POLK)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    100923657 (POLK)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:shr03400]
    100923657 (POLK)
Enzymes [BR:shr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     100923657 (POLK)
DNA repair and recombination proteins [BR:shr03400]
 Eukaryotic type
  TLS (translesion DNA synthesis) factors
   Y-family DNA polymerases
    100923657 (POLK)
SSDB
Motif
Pfam: IMS IMS_C IMS_HHH ATP-cone Cdd1 IFT46_B_C
Other DBs
NCBI-GeneID: 100923657
NCBI-ProteinID: XP_012396575
Ensembl: ENSSHAG00000006899
LinkDB
Position
1
AA seq 865 aa
MGNTKENNNDKDDLMLRMGLNDNKAGMEGLDKEKINKIIMEATKGSRFYENELKKEKQVN
QRIENMMQQKSQITTQQLWKAQLQVDKLAMELEQNRNLCCTIIHIDMDAFYAAVEMRDNP
ELRDKPIAVGSMSMLSTSNYHARRFGVRAAMPGFIAKRLCPQLTIVPPNFDKYREVSKEV
REILADYDPNFMAMSLDEAYLNITKHLEERQNWPEDKRRYFIKRGNPTENDKPETVISGA
PELNEAALSISPLLFEDSPPHLQQQEPEIPSQAHFEEQRDPQVLQNSVIFGTSADEVVKE
IRFRIEQKTSLTASAGIAPNTMLAKVCSDKNKPNGQYQISPNRQAVMDFIKDLPIRKVPG
IGKVTEKMLKALGIVTCSDLYQKRALLSLLFSETSWHSFLHISLGLGSTQMERDGERKSM
SIERTFSEINKAEELYSLCQELCNDLAQDLQREGLKGKTVTIKLKNVNFEVKTRASTVAA
VVSTAEEIFAIAKELLKVEIDADYPQPLRLRLMGVRISGFSSEEDRKHRQKSIISFLKVG
SHTIDPVGSVLEKNNQDQVMKPPETSHKQSFFTKKRSEMSWNHQDAFKFEPETIQGFQVS
QPSSLSKEKMKENLETSENLDDYQIFTCPICFKEQGRMCLETFNRHVDECLSRTLIDCDS
KMMAVPQSSSFCSEVNPDLKPHNIIESHLVDFVPSISIDVLPQGKSTEVLNTGTEEEHSQ
NQYSNLWSKSSLVEYIYQNSPHENEGYHAKTSSGQTTLQTCLLRDKTLVCPVCNLEQRTS
DLMLFNSHVDICLNKGLIQELRKDKASLVVNYPTENPKSNGSSSKIQKAVNIIAKPKRPG
LMTQNSASKKTKPNNFKYTIDSFFK
NT seq 2598 nt   +upstreamnt  +downstreamnt
atgggtaatacaaaagagaataacaatgacaaagatgaccttatgcttagaatgggactc
aatgataacaaagcaggaatggaaggattagataaagagaaaataaataaaatcatcatg
gaagccaccaaggggtctagattttatgaaaatgagctcaaaaaggaaaagcaagtaaac
caacgaattgaaaatatgatgcaacaaaaatctcaaattaccactcagcagctctggaaa
gcacaattacaggttgacaagcttgcaatggagttggaacagaaccgcaacctgtgctgc
actataatacacattgacatggatgctttctatgctgctgtagaaatgagagataatcca
gaactgagggataaacccatcgcagtaggatcaatgagtatgttgtctacttcaaattat
catgcaagaagatttggagtacgggcagctatgcctggatttattgctaagagactctgc
ccacaattaacaatagtgcccccaaactttgacaaatatcgagaagtgagtaaagaggtt
agagaaattcttgccgattatgatcccaattttatggccatgagccttgatgaagcctat
ttgaatataacaaagcacttagaggaaagacaaaactggcctgaggataaaagaagatat
ttcatcaaaagaggaaaccctacagaaaatgataaaccagaaactgtcatatcaggggca
ccagaattaaatgaagctgccctatccatttctcctttgctctttgaagatagccctcct
catctacagcaacaagaaccagaaattccttcccaagcacactttgaagaacagagagat
cctcaagtcctccaaaattcagttatttttgggacttcagctgacgaagttgtaaaggaa
attagattcagaattgaacaaaaaacatctctgacagccagtgcaggcattgctccaaat
acaatgttagcaaaagtatgcagtgataaaaataaaccaaatggacagtaccagatttct
cctaatagacaagctgtaatggacttcatcaaggatttacccattagaaaggttccagga
atagggaaagtaactgagaaaatgttaaaagcacttggaattgtcacctgctcagacctt
taccagaagagggccctactatctcttcttttttctgaaacatcttggcatagcttcctt
catatttcccttggtctaggttcaacacaaatggaaagggatggagagaggaaaagtatg
agcattgaaagaacattcagtgaaataaataaagcagaggaactgtatagcttgtgccaa
gaactttgtaatgatcttgctcaggatctacagagagaaggacttaagggcaaaacagtc
acaattaaactgaagaatgtgaattttgaagtaaaaactcgagcatctactgtagcagct
gttgtttctactgcagaagaaatatttgctattgctaaggaactactaaaagtagaaatt
gatgctgattatccacagcccttacgactacgacttatgggcgtacggatatcaggcttt
tccagtgaagaagacaggaagcaccgacaaaaaagcatcattagcttcttaaaagttgga
agccacaccatagatccagttgggtctgtgctggagaaaaataaccaagatcaagttatg
aaacctccagaaacatctcacaagcagagtttcttcactaaaaagcggtcagaaatgagt
tggaaccatcaagatgcctttaaatttgaacctgaaactatccaaggcttccaagtttca
cagccatctagtctttcaaaggaaaaaatgaaagagaatttagaaacatcagaaaattta
gatgactatcagatctttacttgtcctatttgttttaaggaacaaggaagaatgtgtttg
gaaacatttaacaggcatgtggatgaatgtctcagtaggacattgatagactgtgactcc
aaaatgatggctgtcccacaatcatcgtctttttgttcagaagtaaatccagatttaaaa
ccccataatattatagaaagccatttagtggattttgtcccttcaataagtatagatgtg
cttcctcaaggaaaaagtacagaggttttaaacacaggaaccgaggaagagcacagtcaa
aatcagtattctaatctctggagcaagtcttctcttgttgaatatatttatcaaaattct
ccccatgaaaatgaaggatatcatgccaaaacttcaagtgggcaaacaaccctccagacc
tgcttgctaagagacaaaactttggtgtgtcctgtttgtaatttagagcaaaggacttct
gatctgatgctcttcaatagtcatgtagatatttgcttaaataaaggtcttatccaggaa
ttaaggaaggacaaagctagtctggtcgtaaattatccaacagaaaatcctaaaagtaat
gggagctctagcaaaatacagaaagccgtgaatatcatagcaaaacccaaaaggccagga
ttgatgacccagaattcagcatcaaagaaaaccaaaccaaataatttcaaatatacaatt
gatagcttttttaaatga

DBGET integrated database retrieval system