KEGG   Sarcophilus harrisii (Tasmanian devil): 100923843
Entry
100923843         CDS       T02286                                 

Gene name
FHIT
Definition
(RefSeq) bis(5'-adenosyl)-triphosphatase
  KO
K01522  bis(5'-adenosyl)-triphosphatase [EC:3.6.1.29]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr00230  Purine metabolism
shr01100  Metabolic pathways
shr05222  Small cell lung cancer
shr05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:shr00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100923843 (FHIT)
 09160 Human Diseases
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100923843 (FHIT)
   05223 Non-small cell lung cancer
    100923843 (FHIT)
Enzymes [BR:shr01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.29  bis(5'-adenosyl)-triphosphatase
     100923843 (FHIT)
SSDB
Motif
Pfam: HIT DcpS_C
Other DBs
NCBI-GeneID: 100923843
NCBI-ProteinID: XP_031794110
LinkDB
Position
1
AA seq 221 aa
MRPTGPSPCGGSGKGPGQVFPDSAFPAAVQTQKTARTGFSLCLPPRGKPRCRSRCRPEPR
LPDKPRLELPGRMSFRFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLVCPLRPVERFR
DLNPSEVADLFQMAQRVGNVVEKHFQGTSLTFSIQDGPESGQTVKHVHVHILPRKTGDFS
RNDSIYDELQKHDKIGEDSPAMWRSEDEMAAEAAELRKYFQ
NT seq 666 nt   +upstreamnt  +downstreamnt
atgagacccactggcccctccccctgtggaggaagcggtaaagggccgggccaggtattt
cctgattctgccttcccggccgcggtccagacacagaaaacagcccggaccggtttctcc
ctgtgccttcctccacgtgggaagccccgctgccgcagccgctgccggccagagccccgg
ctccccgacaagcccagacttgagctaccaggaagaatgtctttcagatttggacagcat
ctcatcaagccttccgtggtgtttttgaagacagaattgtccttcgctcttgtgaacagg
aagccagtggtaccaggacatgtcttggtgtgtcccctgcgccccgtggaacgtttccgt
gacctgaatcccagtgaagtggcagatttgtttcagatggcccaaagggttggaaatgtg
gtggagaaacatttccagggaacttccctcaccttttccattcaggatgggcctgaatct
ggacagactgtgaagcatgttcatgttcatatacttcctaggaagactggagactttagc
agaaatgacagcatctatgatgagcttcagaagcatgataaaataggagaagattctcca
gctatgtggaggtcagaagatgaaatggcagcagaagcagctgagctccggaaatatttt
caataa

DBGET integrated database retrieval system