KEGG   Sarcophilus harrisii (Tasmanian devil): 100924183
Entry
100924183         CDS       T02286                                 

Gene name
PAX8
Definition
(RefSeq) paired box protein Pax-8 isoform X1
  KO
K09293  paired box protein 8
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr04918  Thyroid hormone synthesis
shr05200  Pathways in cancer
shr05202  Transcriptional misregulation in cancer
shr05216  Thyroid cancer
Brite
KEGG Orthology (KO) [BR:shr00001]
 09150 Organismal Systems
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    100924183 (PAX8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100924183 (PAX8)
   05202 Transcriptional misregulation in cancer
    100924183 (PAX8)
  09162 Cancer: specific types
   05216 Thyroid cancer
    100924183 (PAX8)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:shr03000]
    100924183 (PAX8)
Transcription factors [BR:shr03000]
 Eukaryotic type
  Helix-turn-helix
   Paired box domain only
    100924183 (PAX8)
SSDB
Motif
Pfam: PAX Pax2_C HTH_23 HTH_Tnp_IS1 Ribosomal_S13_N
Other DBs
NCBI-GeneID: 100924183
NCBI-ProteinID: XP_031805742
Ensembl: ENSSHAG00000011845
LinkDB
Position
2
AA seq 459 aa
MPHNSIRSGHGGLNQLGGAFVNGRPLPEVVRQRIVDLAHQGVRPCDISRQLRVSHGCVSK
ILGSRYYETGSIRPGVIGGSKPKVATPKVVEKIGDYKRQNPTMFAWEIRDRLLAEGVCDN
DTVPSVSSINRIIRTKVQQPFNLPMDSCVASKSLSPGHTLIPSSAVTPPESPQSDSLGST
YSINGLLGIAQPGNESKRKMDDSDQDSCRLSIDSQSSGSGPRKHLRTDTFSQHHLESLDC
PFERQHYTEAYPSPSHTKGEQGLYPLPLLNSAMDDGKATLTPSNTPLGRNLSAHQTYPVV
ADPHSPFAIKQETPDGSSSSSTPSSLSSSAFLDLQQVGSGAPAGASVPSFNAFPHAASVY
GQFTGQALLAGREMVGPTLPGYPPHIPTSGQGSYASSAIAGMVAAGSDYSGNAYGHSPYS
SYSEAWRFPNSSLLSSPYYYSSTSRANAPPTTASAFDHL
NT seq 1380 nt   +upstreamnt  +downstreamnt
atgcctcacaactccatccgctcgggccacggggggctgaaccagttgggtggagccttt
gtgaacggccggcctctccctgaggtggtgcgccagcgcattgtggacctggctcatcag
ggtgtgaggccctgcgacatctcacgccagctccgggtgagccacggctgtgtcagcaag
atactgggcagtaggtactacgagactgggagtatccggcctggagtgattgggggctcg
aagccaaaggtggccacccctaaggtggtggagaagattggggactataagcggcaaaat
ccaaccatgtttgcttgggagattcgggacaggctcctggctgaaggagtctgtgacaat
gataccgtccccagcgtcagctcaatcaacagaattattcggaccaaagtacagcagcca
ttcaacctccccatggacagctgtgtagcttccaagtctctgagtccaggacataccctg
atccccagctcagctgtgacacccccagagtctccacagtcagattcgctaggttcgacc
tactccatcaatgggctcttggggattgctcagcctggcaatgaaagcaagaggaaaatg
gatgacagtgaccaggacagctgccgactgagcatcgactctcagagcagtgggagcggc
ccccgaaagcacctgaggacagacacattcagccagcatcacctggagtcgctggattgc
ccatttgagaggcaacactacacggaggcttacccatctcccagccacaccaaaggcgag
cagggtctctatcctctacccctgctcaacagtgccatggacgatgggaaggccacgctg
actccttccaacacaccgcttggccgcaacctctcggctcaccagacgtaccccgtggtg
gcagatcctcattcacccttcgccataaagcaggaaacccccgatgggtccagttctagc
tccaccccttcctctttatctagctcggcctttttggatctgcagcaagtcggctcaggg
gccccagctggtgcctcggtcccatccttcaatgcttttccccatgctgcctccgtgtat
gggcagttcacgggccaggccctccttgcagggcgggagatggtgggacctacgctgccc
ggatacccaccccacatccccaccagtggccagggcagttacgcctcttctgccattgcc
ggcatggtggcagcaggaagcgactactctggaaacgcctatggtcattccccctactcc
tcctacagcgaggcctggcgcttccccaactccagcctgctgagttccccatattattac
agttccacctcaagggcgaacgcgcctcccaccaccgcttcggcctttgaccacctgtag

DBGET integrated database retrieval system