KEGG   Sarcophilus harrisii (Tasmanian devil): 100924267
Entry
100924267         CDS       T02286                                 

Gene name
MAPK9
Definition
(RefSeq) mitogen-activated protein kinase 9 isoform X1
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr01522  Endocrine resistance
shr04010  MAPK signaling pathway
shr04012  ErbB signaling pathway
shr04014  Ras signaling pathway
shr04024  cAMP signaling pathway
shr04068  FoxO signaling pathway
shr04071  Sphingolipid signaling pathway
shr04137  Mitophagy - animal
shr04140  Autophagy - animal
shr04141  Protein processing in endoplasmic reticulum
shr04210  Apoptosis
shr04215  Apoptosis - multiple species
shr04217  Necroptosis
shr04310  Wnt signaling pathway
shr04380  Osteoclast differentiation
shr04510  Focal adhesion
shr04530  Tight junction
shr04620  Toll-like receptor signaling pathway
shr04621  NOD-like receptor signaling pathway
shr04622  RIG-I-like receptor signaling pathway
shr04625  C-type lectin receptor signaling pathway
shr04657  IL-17 signaling pathway
shr04658  Th1 and Th2 cell differentiation
shr04659  Th17 cell differentiation
shr04660  T cell receptor signaling pathway
shr04664  Fc epsilon RI signaling pathway
shr04668  TNF signaling pathway
shr04722  Neurotrophin signaling pathway
shr04723  Retrograde endocannabinoid signaling
shr04728  Dopaminergic synapse
shr04750  Inflammatory mediator regulation of TRP channels
shr04910  Insulin signaling pathway
shr04912  GnRH signaling pathway
shr04914  Progesterone-mediated oocyte maturation
shr04917  Prolactin signaling pathway
shr04920  Adipocytokine signaling pathway
shr04926  Relaxin signaling pathway
shr04930  Type II diabetes mellitus
shr04931  Insulin resistance
shr04932  Non-alcoholic fatty liver disease
shr04933  AGE-RAGE signaling pathway in diabetic complications
shr04935  Growth hormone synthesis, secretion and action
shr05010  Alzheimer disease
shr05012  Parkinson disease
shr05016  Huntington disease
shr05017  Spinocerebellar ataxia
shr05020  Prion disease
shr05022  Pathways of neurodegeneration - multiple diseases
shr05132  Salmonella infection
shr05133  Pertussis
shr05135  Yersinia infection
shr05142  Chagas disease
shr05145  Toxoplasmosis
shr05152  Tuberculosis
shr05161  Hepatitis B
shr05162  Measles
shr05166  Human T-cell leukemia virus 1 infection
shr05167  Kaposi sarcoma-associated herpesvirus infection
shr05169  Epstein-Barr virus infection
shr05170  Human immunodeficiency virus 1 infection
shr05171  Coronavirus disease - COVID-19
shr05200  Pathways in cancer
shr05210  Colorectal cancer
shr05212  Pancreatic cancer
shr05231  Choline metabolism in cancer
shr05415  Diabetic cardiomyopathy
shr05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:shr00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100924267 (MAPK9)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100924267 (MAPK9)
   04012 ErbB signaling pathway
    100924267 (MAPK9)
   04014 Ras signaling pathway
    100924267 (MAPK9)
   04310 Wnt signaling pathway
    100924267 (MAPK9)
   04668 TNF signaling pathway
    100924267 (MAPK9)
   04068 FoxO signaling pathway
    100924267 (MAPK9)
   04071 Sphingolipid signaling pathway
    100924267 (MAPK9)
   04024 cAMP signaling pathway
    100924267 (MAPK9)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100924267 (MAPK9)
   04137 Mitophagy - animal
    100924267 (MAPK9)
  09143 Cell growth and death
   04210 Apoptosis
    100924267 (MAPK9)
   04215 Apoptosis - multiple species
    100924267 (MAPK9)
   04217 Necroptosis
    100924267 (MAPK9)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100924267 (MAPK9)
   04530 Tight junction
    100924267 (MAPK9)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100924267 (MAPK9)
   04621 NOD-like receptor signaling pathway
    100924267 (MAPK9)
   04622 RIG-I-like receptor signaling pathway
    100924267 (MAPK9)
   04625 C-type lectin receptor signaling pathway
    100924267 (MAPK9)
   04660 T cell receptor signaling pathway
    100924267 (MAPK9)
   04658 Th1 and Th2 cell differentiation
    100924267 (MAPK9)
   04659 Th17 cell differentiation
    100924267 (MAPK9)
   04657 IL-17 signaling pathway
    100924267 (MAPK9)
   04664 Fc epsilon RI signaling pathway
    100924267 (MAPK9)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100924267 (MAPK9)
   04920 Adipocytokine signaling pathway
    100924267 (MAPK9)
   04912 GnRH signaling pathway
    100924267 (MAPK9)
   04914 Progesterone-mediated oocyte maturation
    100924267 (MAPK9)
   04917 Prolactin signaling pathway
    100924267 (MAPK9)
   04926 Relaxin signaling pathway
    100924267 (MAPK9)
   04935 Growth hormone synthesis, secretion and action
    100924267 (MAPK9)
  09156 Nervous system
   04728 Dopaminergic synapse
    100924267 (MAPK9)
   04723 Retrograde endocannabinoid signaling
    100924267 (MAPK9)
   04722 Neurotrophin signaling pathway
    100924267 (MAPK9)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100924267 (MAPK9)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100924267 (MAPK9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100924267 (MAPK9)
   05231 Choline metabolism in cancer
    100924267 (MAPK9)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100924267 (MAPK9)
   05212 Pancreatic cancer
    100924267 (MAPK9)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100924267 (MAPK9)
   05170 Human immunodeficiency virus 1 infection
    100924267 (MAPK9)
   05161 Hepatitis B
    100924267 (MAPK9)
   05171 Coronavirus disease - COVID-19
    100924267 (MAPK9)
   05162 Measles
    100924267 (MAPK9)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100924267 (MAPK9)
   05169 Epstein-Barr virus infection
    100924267 (MAPK9)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100924267 (MAPK9)
   05135 Yersinia infection
    100924267 (MAPK9)
   05133 Pertussis
    100924267 (MAPK9)
   05152 Tuberculosis
    100924267 (MAPK9)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100924267 (MAPK9)
   05142 Chagas disease
    100924267 (MAPK9)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100924267 (MAPK9)
   05012 Parkinson disease
    100924267 (MAPK9)
   05016 Huntington disease
    100924267 (MAPK9)
   05017 Spinocerebellar ataxia
    100924267 (MAPK9)
   05020 Prion disease
    100924267 (MAPK9)
   05022 Pathways of neurodegeneration - multiple diseases
    100924267 (MAPK9)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100924267 (MAPK9)
   05415 Diabetic cardiomyopathy
    100924267 (MAPK9)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100924267 (MAPK9)
   04932 Non-alcoholic fatty liver disease
    100924267 (MAPK9)
   04931 Insulin resistance
    100924267 (MAPK9)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100924267 (MAPK9)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100924267 (MAPK9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:shr01001]
    100924267 (MAPK9)
Enzymes [BR:shr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100924267 (MAPK9)
Protein kinases [BR:shr01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   100924267 (MAPK9)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo Kinase-like RIO1 APH FTA2
Other DBs
NCBI-GeneID: 100924267
NCBI-ProteinID: XP_031809671
Ensembl: ENSSHAG00000005542
LinkDB
Position
2
AA seq 424 aa
MSDNKCDSHFYSVQVADSTFTVLKRYQQLKPIGSGAQGIVCAAFDTVVGINVAVKKLSRP
FQNQTHAKRAYRELVLLKCVNHKNIISLLNVFTPQKSLEEFQDVYLVMELMDANLCQVIH
MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTACTNF
MMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGELVKGCVIFQGTDHIDQWNKVIEQ
LGTPSSDFMKKLQPTVRNYVENRPKYPGIKFEELFPDWIFPSESERDKLKTSQARDLLSK
MLVIDPDKRISVDEALRHPYITVWYDPAEAEAPPPQIYDAQLEEREHAIEEWKELIYKEV
MDWEERSKNGVVKDQPSDAAVNSNTTPSQSSSINDISSMSTEQTLASDTDSSLDALTGPI
EGCR
NT seq 1275 nt   +upstreamnt  +downstreamnt
atgagtgacaataaatgtgatagtcatttttatagtgtgcaagttgcagattcaactttc
acagtactgaaacgttaccagcaattaaaaccaataggatctggagctcagggaattgtt
tgcgctgcttttgatacagttgttggaataaatgttgctgtcaagaaattaagtcgacca
tttcagaatcagactcatgcaaagagagcttaccgtgagcttgttctgttaaaatgtgtc
aatcataaaaatataattagcttattgaatgtgttcacaccacagaaatctctagaagaa
tttcaagatgtgtatttggttatggaattaatggatgctaatttatgccaagtgattcat
atggaattggaccatgaaagaatgtcttaccttctttatcaaatgctctgtggtattaaa
cacctccattcagctggtataatacaccgagatttgaaacccagcaatatagtagtaaag
tcagattgtacactcaagatccttgattttggcctggcacggacagcatgtactaatttt
atgatgactccatatgtagttacacggtattatagagcacctgaagttatcttggggatg
ggatacaaagaaaacgttgatatctggtcagtggggtgcatcatgggagaactggtgaaa
ggttgtgtgatattccaaggcactgatcatattgatcagtggaataaagtaattgagcag
ttaggaacaccatcatcagactttatgaagaaattacagccaactgtgaggaattatgta
gaaaacaggccgaaatatcctggtatcaaatttgaagagcttttccctgattggatattc
ccatcagaatctgaacgagataaactgaaaacaagtcaagctagagatttgttatcaaaa
atgctcgtaatagatcctgacaagcgaatttctgtcgatgaagccttacggcacccatat
attactgtttggtatgatcctgctgaagcagaagcaccaccacctcaaatttatgatgcc
cagttagaagaacgagaacatgctattgaagaatggaaagaactaatatacaaagaagta
atggactgggaagaaagaagcaagaatggtgtggtaaaagatcaaccttcagatgcagca
gtaaatagcaacaccactccttctcagtcctcatctatcaatgacatttcatccatgtca
acagagcagacattggcttcagatacagacagcagcctggatgccttgacaggacccatt
gaaggttgtcgatga

KEGG   Sarcophilus harrisii (Tasmanian devil): 100928480
Entry
100928480         CDS       T02286                                 

Gene name
MAPK10
Definition
(RefSeq) mitogen-activated protein kinase 10 isoform X1
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr01522  Endocrine resistance
shr04010  MAPK signaling pathway
shr04012  ErbB signaling pathway
shr04014  Ras signaling pathway
shr04024  cAMP signaling pathway
shr04068  FoxO signaling pathway
shr04071  Sphingolipid signaling pathway
shr04137  Mitophagy - animal
shr04140  Autophagy - animal
shr04141  Protein processing in endoplasmic reticulum
shr04210  Apoptosis
shr04215  Apoptosis - multiple species
shr04217  Necroptosis
shr04310  Wnt signaling pathway
shr04380  Osteoclast differentiation
shr04510  Focal adhesion
shr04530  Tight junction
shr04620  Toll-like receptor signaling pathway
shr04621  NOD-like receptor signaling pathway
shr04622  RIG-I-like receptor signaling pathway
shr04625  C-type lectin receptor signaling pathway
shr04657  IL-17 signaling pathway
shr04658  Th1 and Th2 cell differentiation
shr04659  Th17 cell differentiation
shr04660  T cell receptor signaling pathway
shr04664  Fc epsilon RI signaling pathway
shr04668  TNF signaling pathway
shr04722  Neurotrophin signaling pathway
shr04723  Retrograde endocannabinoid signaling
shr04728  Dopaminergic synapse
shr04750  Inflammatory mediator regulation of TRP channels
shr04910  Insulin signaling pathway
shr04912  GnRH signaling pathway
shr04914  Progesterone-mediated oocyte maturation
shr04917  Prolactin signaling pathway
shr04920  Adipocytokine signaling pathway
shr04926  Relaxin signaling pathway
shr04930  Type II diabetes mellitus
shr04931  Insulin resistance
shr04932  Non-alcoholic fatty liver disease
shr04933  AGE-RAGE signaling pathway in diabetic complications
shr04935  Growth hormone synthesis, secretion and action
shr05010  Alzheimer disease
shr05012  Parkinson disease
shr05016  Huntington disease
shr05017  Spinocerebellar ataxia
shr05020  Prion disease
shr05022  Pathways of neurodegeneration - multiple diseases
shr05132  Salmonella infection
shr05133  Pertussis
shr05135  Yersinia infection
shr05142  Chagas disease
shr05145  Toxoplasmosis
shr05152  Tuberculosis
shr05161  Hepatitis B
shr05162  Measles
shr05166  Human T-cell leukemia virus 1 infection
shr05167  Kaposi sarcoma-associated herpesvirus infection
shr05169  Epstein-Barr virus infection
shr05170  Human immunodeficiency virus 1 infection
shr05171  Coronavirus disease - COVID-19
shr05200  Pathways in cancer
shr05210  Colorectal cancer
shr05212  Pancreatic cancer
shr05231  Choline metabolism in cancer
shr05415  Diabetic cardiomyopathy
shr05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:shr00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100928480 (MAPK10)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100928480 (MAPK10)
   04012 ErbB signaling pathway
    100928480 (MAPK10)
   04014 Ras signaling pathway
    100928480 (MAPK10)
   04310 Wnt signaling pathway
    100928480 (MAPK10)
   04668 TNF signaling pathway
    100928480 (MAPK10)
   04068 FoxO signaling pathway
    100928480 (MAPK10)
   04071 Sphingolipid signaling pathway
    100928480 (MAPK10)
   04024 cAMP signaling pathway
    100928480 (MAPK10)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100928480 (MAPK10)
   04137 Mitophagy - animal
    100928480 (MAPK10)
  09143 Cell growth and death
   04210 Apoptosis
    100928480 (MAPK10)
   04215 Apoptosis - multiple species
    100928480 (MAPK10)
   04217 Necroptosis
    100928480 (MAPK10)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100928480 (MAPK10)
   04530 Tight junction
    100928480 (MAPK10)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100928480 (MAPK10)
   04621 NOD-like receptor signaling pathway
    100928480 (MAPK10)
   04622 RIG-I-like receptor signaling pathway
    100928480 (MAPK10)
   04625 C-type lectin receptor signaling pathway
    100928480 (MAPK10)
   04660 T cell receptor signaling pathway
    100928480 (MAPK10)
   04658 Th1 and Th2 cell differentiation
    100928480 (MAPK10)
   04659 Th17 cell differentiation
    100928480 (MAPK10)
   04657 IL-17 signaling pathway
    100928480 (MAPK10)
   04664 Fc epsilon RI signaling pathway
    100928480 (MAPK10)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100928480 (MAPK10)
   04920 Adipocytokine signaling pathway
    100928480 (MAPK10)
   04912 GnRH signaling pathway
    100928480 (MAPK10)
   04914 Progesterone-mediated oocyte maturation
    100928480 (MAPK10)
   04917 Prolactin signaling pathway
    100928480 (MAPK10)
   04926 Relaxin signaling pathway
    100928480 (MAPK10)
   04935 Growth hormone synthesis, secretion and action
    100928480 (MAPK10)
  09156 Nervous system
   04728 Dopaminergic synapse
    100928480 (MAPK10)
   04723 Retrograde endocannabinoid signaling
    100928480 (MAPK10)
   04722 Neurotrophin signaling pathway
    100928480 (MAPK10)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100928480 (MAPK10)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100928480 (MAPK10)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100928480 (MAPK10)
   05231 Choline metabolism in cancer
    100928480 (MAPK10)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100928480 (MAPK10)
   05212 Pancreatic cancer
    100928480 (MAPK10)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100928480 (MAPK10)
   05170 Human immunodeficiency virus 1 infection
    100928480 (MAPK10)
   05161 Hepatitis B
    100928480 (MAPK10)
   05171 Coronavirus disease - COVID-19
    100928480 (MAPK10)
   05162 Measles
    100928480 (MAPK10)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100928480 (MAPK10)
   05169 Epstein-Barr virus infection
    100928480 (MAPK10)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100928480 (MAPK10)
   05135 Yersinia infection
    100928480 (MAPK10)
   05133 Pertussis
    100928480 (MAPK10)
   05152 Tuberculosis
    100928480 (MAPK10)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100928480 (MAPK10)
   05142 Chagas disease
    100928480 (MAPK10)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100928480 (MAPK10)
   05012 Parkinson disease
    100928480 (MAPK10)
   05016 Huntington disease
    100928480 (MAPK10)
   05017 Spinocerebellar ataxia
    100928480 (MAPK10)
   05020 Prion disease
    100928480 (MAPK10)
   05022 Pathways of neurodegeneration - multiple diseases
    100928480 (MAPK10)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100928480 (MAPK10)
   05415 Diabetic cardiomyopathy
    100928480 (MAPK10)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100928480 (MAPK10)
   04932 Non-alcoholic fatty liver disease
    100928480 (MAPK10)
   04931 Insulin resistance
    100928480 (MAPK10)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100928480 (MAPK10)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100928480 (MAPK10)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:shr01001]
    100928480 (MAPK10)
Enzymes [BR:shr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100928480 (MAPK10)
Protein kinases [BR:shr01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   100928480 (MAPK10)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo Kinase-like RIO1 APH FTA2
Other DBs
NCBI-GeneID: 100928480
NCBI-ProteinID: XP_031798997
Ensembl: ENSSHAG00000002029
LinkDB
Position
6
AA seq 467 aa
MVFMSRYFLSYFGEPTFDVKIAFCQGFDKQVDVSYIAKYYNMSKSKVDNQFYSVEVGDST
FTVLKRYQNLKPIGSGAQGIVCAAYDAVLDRNVAIKKLSRPFQNQTHAKRAYRELVLMKC
VNHKNIISLLNVFTPQKSLEEFQDVYLVMELMDANLCQVIQMELDHERMSYLLYQMLCGI
KHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSFMMTPYVVTRYYRAPEVILG
MGYKENVDIWSVGCIMGEMVRHKILFPGRDYIDQWNKVIEQLGTPCPEFMKKLQPTVRNY
VENRPKYAGLTFPKLFPDSLFPADSEHNKLKASQARDLLSKMLVIDPAKRISVDDALQHP
YINVWYDPAEVEAPPPQIYDKQLDEREHTIEEWKELIYKEVMNSEEKTKNGVVKGQPSPS
GAAVNSSESLPPSSSVNDISSMSTDQTLASDTDSSLETSAGPLGCCR
NT seq 1404 nt   +upstreamnt  +downstreamnt
atggtatttatgagccgctacttcttgtcctacttcggtgaacctaccttcgatgtgaaa
attgccttttgtcagggatttgataaacaagtggatgtgtcatatattgccaaatattac
aacatgagcaaaagcaaagtagacaaccagttctacagtgtagaagtgggagattcaaca
ttcacagttctcaaacgctaccagaatctaaagcctattggctctggggctcagggaatc
gtttgtgctgcatatgatgctgtccttgacagaaatgtggctattaagaagctcagcaga
ccatttcagaaccaaacacatgcaaaacgagcttacagggagctggtcctcatgaagtgt
gtgaatcataaaaatattatcagtttattaaatgtcttcacaccacagaaatcactggaa
gaatttcaagatgtttaccttgtgatggaattgatggatgcaaacttgtgtcaggtaatt
caaatggaattggatcatgagcgcatgtcttacctcctataccaaatgttatgtggaatc
aagcaccttcattctgctgggatcatccacagggatttaaagcctagtaacattgtggtg
aagtctgactgcacattgaaaattctggactttggactggccaggactgcaggcacaagc
ttcatgatgactccatatgtggtgacacgatattacagagcaccagaagtcatcttggga
atgggctacaaagagaatgtggatatatggtctgtaggatgcattatgggagaaatggtt
cgtcacaaaatcctctttccaggaagggattatattgatcaatggaacaaagtaattgaa
caattaggaacaccatgtccagaattcatgaagaaattgcaacccacagtaagaaactac
gtggagaatcggcccaagtatgcaggtcttactttccccaagctctttccagattccctc
ttccctgctgactccgagcacaataaacttaaagccagccaagccagggaccttttgtca
aagatgctagtgattgatccagccaaaaggatatcggtggatgatgccttacagcatcca
tacatcaacgtctggtatgatcctgcagaagtggaggcgcctcctccacagatatatgat
aaacaactggatgaaagagaacataccattgaagaatggaaagaattgatctataaggaa
gtaatgaattctgaagaaaagactaaaaatggagtagtaaaaggacaaccttctccttca
ggtgcagcagtgaacagcagcgagagcctccctccatcctcttctgtcaacgacatctcc
tccatgtccactgaccagaccctggcatccgacactgacagtagcttggagacctcggca
ggaccacttggttgttgcaggtga

KEGG   Sarcophilus harrisii (Tasmanian devil): 100930815
Entry
100930815         CDS       T02286                                 

Gene name
MAPK8
Definition
(RefSeq) mitogen-activated protein kinase 8 isoform X1
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr01522  Endocrine resistance
shr04010  MAPK signaling pathway
shr04012  ErbB signaling pathway
shr04014  Ras signaling pathway
shr04024  cAMP signaling pathway
shr04068  FoxO signaling pathway
shr04071  Sphingolipid signaling pathway
shr04137  Mitophagy - animal
shr04140  Autophagy - animal
shr04141  Protein processing in endoplasmic reticulum
shr04210  Apoptosis
shr04215  Apoptosis - multiple species
shr04217  Necroptosis
shr04310  Wnt signaling pathway
shr04380  Osteoclast differentiation
shr04510  Focal adhesion
shr04530  Tight junction
shr04620  Toll-like receptor signaling pathway
shr04621  NOD-like receptor signaling pathway
shr04622  RIG-I-like receptor signaling pathway
shr04625  C-type lectin receptor signaling pathway
shr04657  IL-17 signaling pathway
shr04658  Th1 and Th2 cell differentiation
shr04659  Th17 cell differentiation
shr04660  T cell receptor signaling pathway
shr04664  Fc epsilon RI signaling pathway
shr04668  TNF signaling pathway
shr04722  Neurotrophin signaling pathway
shr04723  Retrograde endocannabinoid signaling
shr04728  Dopaminergic synapse
shr04750  Inflammatory mediator regulation of TRP channels
shr04910  Insulin signaling pathway
shr04912  GnRH signaling pathway
shr04914  Progesterone-mediated oocyte maturation
shr04917  Prolactin signaling pathway
shr04920  Adipocytokine signaling pathway
shr04926  Relaxin signaling pathway
shr04930  Type II diabetes mellitus
shr04931  Insulin resistance
shr04932  Non-alcoholic fatty liver disease
shr04933  AGE-RAGE signaling pathway in diabetic complications
shr04935  Growth hormone synthesis, secretion and action
shr05010  Alzheimer disease
shr05012  Parkinson disease
shr05016  Huntington disease
shr05017  Spinocerebellar ataxia
shr05020  Prion disease
shr05022  Pathways of neurodegeneration - multiple diseases
shr05132  Salmonella infection
shr05133  Pertussis
shr05135  Yersinia infection
shr05142  Chagas disease
shr05145  Toxoplasmosis
shr05152  Tuberculosis
shr05161  Hepatitis B
shr05162  Measles
shr05166  Human T-cell leukemia virus 1 infection
shr05167  Kaposi sarcoma-associated herpesvirus infection
shr05169  Epstein-Barr virus infection
shr05170  Human immunodeficiency virus 1 infection
shr05171  Coronavirus disease - COVID-19
shr05200  Pathways in cancer
shr05210  Colorectal cancer
shr05212  Pancreatic cancer
shr05231  Choline metabolism in cancer
shr05415  Diabetic cardiomyopathy
shr05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:shr00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100930815 (MAPK8)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100930815 (MAPK8)
   04012 ErbB signaling pathway
    100930815 (MAPK8)
   04014 Ras signaling pathway
    100930815 (MAPK8)
   04310 Wnt signaling pathway
    100930815 (MAPK8)
   04668 TNF signaling pathway
    100930815 (MAPK8)
   04068 FoxO signaling pathway
    100930815 (MAPK8)
   04071 Sphingolipid signaling pathway
    100930815 (MAPK8)
   04024 cAMP signaling pathway
    100930815 (MAPK8)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100930815 (MAPK8)
   04137 Mitophagy - animal
    100930815 (MAPK8)
  09143 Cell growth and death
   04210 Apoptosis
    100930815 (MAPK8)
   04215 Apoptosis - multiple species
    100930815 (MAPK8)
   04217 Necroptosis
    100930815 (MAPK8)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100930815 (MAPK8)
   04530 Tight junction
    100930815 (MAPK8)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100930815 (MAPK8)
   04621 NOD-like receptor signaling pathway
    100930815 (MAPK8)
   04622 RIG-I-like receptor signaling pathway
    100930815 (MAPK8)
   04625 C-type lectin receptor signaling pathway
    100930815 (MAPK8)
   04660 T cell receptor signaling pathway
    100930815 (MAPK8)
   04658 Th1 and Th2 cell differentiation
    100930815 (MAPK8)
   04659 Th17 cell differentiation
    100930815 (MAPK8)
   04657 IL-17 signaling pathway
    100930815 (MAPK8)
   04664 Fc epsilon RI signaling pathway
    100930815 (MAPK8)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100930815 (MAPK8)
   04920 Adipocytokine signaling pathway
    100930815 (MAPK8)
   04912 GnRH signaling pathway
    100930815 (MAPK8)
   04914 Progesterone-mediated oocyte maturation
    100930815 (MAPK8)
   04917 Prolactin signaling pathway
    100930815 (MAPK8)
   04926 Relaxin signaling pathway
    100930815 (MAPK8)
   04935 Growth hormone synthesis, secretion and action
    100930815 (MAPK8)
  09156 Nervous system
   04728 Dopaminergic synapse
    100930815 (MAPK8)
   04723 Retrograde endocannabinoid signaling
    100930815 (MAPK8)
   04722 Neurotrophin signaling pathway
    100930815 (MAPK8)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100930815 (MAPK8)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100930815 (MAPK8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100930815 (MAPK8)
   05231 Choline metabolism in cancer
    100930815 (MAPK8)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100930815 (MAPK8)
   05212 Pancreatic cancer
    100930815 (MAPK8)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100930815 (MAPK8)
   05170 Human immunodeficiency virus 1 infection
    100930815 (MAPK8)
   05161 Hepatitis B
    100930815 (MAPK8)
   05171 Coronavirus disease - COVID-19
    100930815 (MAPK8)
   05162 Measles
    100930815 (MAPK8)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100930815 (MAPK8)
   05169 Epstein-Barr virus infection
    100930815 (MAPK8)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100930815 (MAPK8)
   05135 Yersinia infection
    100930815 (MAPK8)
   05133 Pertussis
    100930815 (MAPK8)
   05152 Tuberculosis
    100930815 (MAPK8)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100930815 (MAPK8)
   05142 Chagas disease
    100930815 (MAPK8)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100930815 (MAPK8)
   05012 Parkinson disease
    100930815 (MAPK8)
   05016 Huntington disease
    100930815 (MAPK8)
   05017 Spinocerebellar ataxia
    100930815 (MAPK8)
   05020 Prion disease
    100930815 (MAPK8)
   05022 Pathways of neurodegeneration - multiple diseases
    100930815 (MAPK8)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100930815 (MAPK8)
   05415 Diabetic cardiomyopathy
    100930815 (MAPK8)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100930815 (MAPK8)
   04932 Non-alcoholic fatty liver disease
    100930815 (MAPK8)
   04931 Insulin resistance
    100930815 (MAPK8)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100930815 (MAPK8)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100930815 (MAPK8)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:shr01001]
    100930815 (MAPK8)
Enzymes [BR:shr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100930815 (MAPK8)
Protein kinases [BR:shr01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   100930815 (MAPK8)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo Kinase-like RIO1 APH FTA2 DUF530
Other DBs
NCBI-GeneID: 100930815
NCBI-ProteinID: XP_031812152
Ensembl: ENSSHAG00000017573
LinkDB
Position
2
AA seq 427 aa
MSRSKRDSNFYSVEIGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAILERNVAIKKLSRP
FQNQTHAKRAYRELVLMKCVNHKNIIGLLNVFTPQKSLEEFQDVYIVMELMDANLCQVIQ
MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSF
MMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGEMIKGGVLFPGTDHIDQWNKVIEQ
LGTPCPEFMKKLQPTVRTYVENRPKYAGYSFEKLFPDVLFPADSEHNKLKASQARDLLSK
MLVIDASKRISVDEALQHPYINVWYDPSEAEAPPPKIPDKQLDEREHTIEEWKELIYKEV
MDLEERTKNGVIRGQPAPLGAAVISGSQHPSSSSSVNDVSSMSTDPTLASDTDSSLETSA
GPLGCCR
NT seq 1284 nt   +upstreamnt  +downstreamnt
atgagcaggagcaagcgtgacagtaatttctatagtgtagagattggagattcgacattt
actgtactgaaacggtatcagaatttaaaacctataggctcaggggcccagggaatagtg
tgtgcagcttatgatgccattcttgaaagaaatgttgcaattaagaagctaagccgacca
tttcagaatcagactcatgccaagcgtgcttatagagagcttgttcttatgaaatgtgtt
aatcacaaaaatataattggcctcttgaatgtgttcacaccacagaaatccctagaagaa
tttcaggatgtttacatagtcatggagctcatggatgcaaatctttgccaagtgattcaa
atggagctagaccatgaacgaatgtcctaccttctctatcagatgctgtgtggaatcaag
caccttcattctgctggaattatacatcgagacttaaagcccagtaatatagtagtaaaa
tcagactgcactttgaagattcttgactttggactggccagaactgcaggaactagtttt
atgatgacaccttatgtagtgactcgttactacagagcacccgaggtcatcctagggatg
ggctacaaagaaaacgttgacatttggtcagttgggtgcatcatgggagaaatgatcaaa
ggtggtgttttgttcccaggtacagatcatattgatcaatggaataaagttattgagcaa
cttggaacaccttgtcctgagttcatgaagaaattacaaccaacagtaagaacttatgtg
gagaacagacctaaatatgctggatatagctttgagaagctcttcccagatgtacttttc
ccagctgactcggagcacaacaaacttaaagctagtcaggcaagggatttgttgtcaaaa
atgctggttatagatgcatctaaaagaatctctgtggatgaagccctccagcacccttat
atcaatgtctggtatgatccttcagaagcagaagcgcctccaccaaagatacctgacaag
cagttagatgaaagggagcacacaatagaagagtggaaagaattgatatacaaggaagtc
atggacttggaggagagaactaagaatggagttatacggggtcaaccagctcctttaggt
gcagcagtgattagtggttctcaacatccatcttcatcgtcgtctgtcaatgatgtgtct
tcaatgtcaacagatccaacattggcctctgatacagacagcagtctagaaacatcagct
ggacctctgggctgctgtagatga

DBGET integrated database retrieval system