KEGG   Sarcophilus harrisii (Tasmanian devil): 100924299Help
Entry
100924299         CDS       T02286                                 

Gene name
SDHB
Definition
(RefSeq) succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr00020  Citrate cycle (TCA cycle)
shr00190  Oxidative phosphorylation
shr01100  Metabolic pathways
shr01200  Carbon metabolism
shr04714  Thermogenesis
shr04932  Non-alcoholic fatty liver disease (NAFLD)
shr05010  Alzheimer disease
shr05012  Parkinson disease
shr05016  Huntington disease
Module
shr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
shr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
shr_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:shr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    100924299 (SDHB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    100924299 (SDHB)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    100924299 (SDHB)
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05010 Alzheimer disease
    100924299 (SDHB)
   05012 Parkinson disease
    100924299 (SDHB)
   05016 Huntington disease
    100924299 (SDHB)
  09167 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100924299 (SDHB)
Enzymes [BR:shr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     100924299 (SDHB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer2 Fer4_9 Fer4_18 Fer4_7
Motif
Other DBs
NCBI-GeneID: 100924299
NCBI-ProteinID: XP_023355693
LinkDB All DBs
Position
3
AA seq 274 aa AA seqDB search
MLGKLFILTCTISFPSLQTCRGAQTAAAAAPRLKKFAIYRWDPDKPGDKPRMQTYEIDLN
RCGPMVLDALIKIKNEMDATLTFRRSCREGICGSCAMNINGGNTLACTRRIDSNLSKVSK
IYPLPHMYVMKDLVPDLNNFYAQYKSIQPYLKKKDESQEGKEQYLQSIEDREKLDGLYEC
ILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAQLQDPFSLYRCHTI
MNCTKTCPKGLNPGKAIAEIKKMMATYKEKKASA
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgttgggcaaactatttattcttacttgcacgatttctttcccctcacttcagacatgc
cgaggggctcagacagcagctgcagcagctccccgcctcaagaaatttgccatctataga
tgggacccagacaagcctggagataagccccggatgcagacgtatgaaattgatctgaac
agatgtggcccgatggtgttagatgccttgatcaagattaaaaatgagatggatgccaca
ctgaccttccgaagatcgtgccgagaaggcatctgcggttcctgtgcaatgaatatcaat
gggggcaacacactggcttgcaccagaagaatcgactccaatctcagcaaagtctccaaa
atctaccctcttccccatatgtacgtgatgaaggatctggtcccggatttgaataacttt
tatgcacagtacaaatccattcagccttacctgaagaagaaggatgaatcccaagagggc
aaggagcaatatcttcagtccatagaagaccgagagaaactggacgggctctacgagtgc
attctctgtgcctgctgcagcaccagctgtcccagttactggtggaacggagacaaatac
ttgggacccgcagtcctcatgcaggcctaccgctggatgattgactccagggacgacttc
acagaggagcggctggcccagctccaggacccgttctctttgtaccgatgtcacaccatc
atgaactgcaccaagacctgccctaaggggctgaatccaggaaaagccatagctgaaatc
aagaagatgatggccacctacaaggagaagaaggcgagcgcttag

DBGET integrated database retrieval system