KEGG   Sarcophilus harrisii (Tasmanian devil): 100924421Help
Entry
100924421         CDS       T02286                                 

Gene name
HDAC7
Definition
(RefSeq) histone deacetylase 7
  KO
K11408  histone deacetylase 7 [EC:3.5.1.98]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr05034  Alcoholism
shr05165  Human papillomavirus infection
shr05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:shr00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    100924421 (HDAC7)
  Substance dependence
   05034 Alcoholism
    100924421 (HDAC7)
  Infectious diseases
   05165 Human papillomavirus infection
    100924421 (HDAC7)
Enzymes [BR:shr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     100924421 (HDAC7)
Chromosome and associated proteins [BR:shr03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     100924421 (HDAC7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 100924421
NCBI-ProteinID: XP_012407103
Ensembl: ENSSHAG00000002512
LinkDB All DBs
Position
5
AA seq 1002 aa AA seqDB search
MQSSRLREGNNKKRQPVQRPGSVHLDGTQVSPGPQYSSPPGTASSTICPGLSVPQLQPMD
LRVGQRPPVEPASEPTLLALQRSQHLHHQLFLAGLQHQQVEHIQLSLETPVQEAPGGHQE
QELRQLLHKDKSKRSAVASHAVKQKLAEVILKKQQAALERTTHSSIPFRTLGSLETEGTS
STMLNSFLPMVPSLLSDSPEHFPLRKTVSEPNLKLRYKPKKSLELRKNPLLRKESAPPSL
RRRPTEPLGDSSPSSSSTPVSGCSSPNDSEHGPIAAVGSEELLAQRLRLQESSLAPFALS
TVSTLPEITLGLPATTRADGDRRIHPALGSRGPVLGSPHGPLFLPPGLESEAGGTLASHL
QPILILEPSISHPPLLTVPGIGPLPFHFAQSLLSSERLSGSGPHTPLSRTRSEPLPPSTT
APQPPSSLQPRLDWLKQHSQSKRPTKPSEKPRLRQIPSAEDLETNEALIQGPEHRDLGHG
KPEVGSAASSQQHQQILLWEQQQRLLGRLARGSLGDSVLLPSTQSGHRPLSRAQSSPAAP
ISLPTSEPPNQTLVLSCPETPARTLPYTTGLVYDSVMLKHQCSCGDNSNHPEHAGRIQSI
WSRLQERGLRSQCECLRGRKASLEELQSVHDERHVLLYGTNPLSRLKLDNGKLAGILAQR
MFVMLPCGGVGVDTDTIWNELHSSNAARWAAGSVTDLAFKVAARELKNGFAVVRPPGHHA
DHSTAMGFCFFNSVAIASRQLQQQGKVSKILIVDWDVHHGNGTQQTFYEDPSVLYISLHR
HDDGNFFPGSGAVDEVGAGNGEGFNINVAWAGGLDPPMGDPEYLAAFRTVVMPIAQEFSP
DLVMVSAGFDAADGHPPPLGGYHVSAKCFGYMTQQLMSLAGGAVVLALEGGHDLTAICDA
SEACVTALLGNKVDPLSEESWKQKPNLNAIRSLEAVIRVHSKYWGSMQWLASSPDSWVPS
VAMADTEEVETVSALASLSVGILTEKRPSEQLVEEEEEPMNL
NT seq 3009 nt NT seq  +upstreamnt  +downstreamnt
atgcagtcatctaggctcagggaaggaaacaacaagaaaagacagccagttcaaagacca
ggctcagttcacctagatgggacccaggtgagccctggcccccagtattccagcccccct
ggcacagccagttccaccatctgtcctgggctgtcagttcctcagctccagcccatggac
cttcgggtgggacagaggccccctgtggagcctgcatcagaaccaactctgctggctctt
cagcgctctcagcatctgcatcatcagctctttcttgctggtctccagcatcaacaggta
gaacacattcagctctccctggagactccagtgcaagaggcaccaggaggccatcaagag
caggagctgaggcaacttctccacaaggacaagagcaaacggagtgctgtggccagccat
gctgtgaaacagaaattggctgaagtcattctgaagaagcagcaggcagcattggaaaga
actacccattccagcattcccttcagaaccctggggtctctagaaacagaaggaacatcc
tccaccatgctgaacagtttcctgcccatggtccccagcctgctcagtgactctccagaa
cactttccccttcgtaagacagtctcagagcccaacctgaagctacgttacaagcccaag
aagtctttggagttgaggaagaatccactgctccgcaaagagagtgctcctcccagcctt
cgtcgacgtccaaccgagccccttggggattcatcccctagcagtagcagcactcctgtt
tcaggttgcagctcccccaatgacagtgaacatggtcctatagctgctgtgggctcagag
gaacttttagcccaacgacttcgactccaggaaagttcgcttgccccatttgccttgtca
acggtatctacacttcccgaaatcaccctgggcctgcctgccaccactagggctgatggt
gaccgaaggattcatcctgctttggggtcccggggacctgttctggggagtccgcatggt
cccctcttcctccccccaggcttagaatctgaggcagggggtactttggcatcccaccta
caacccatcctcatcctggagccctcaatatctcatcccccactgctgactgtgcctggg
attgggccactacccttccattttgcccaatcactactctccagtgaacggctttcaggg
tcaggccctcacacaccactgagccggacacgctcagagcccctgcccccaagcaccact
gctccgcagccaccaagctccctgcagccccgcctggattggctaaaacagcactcacag
agcaagaggccaacaaaaccaagtgagaagcctcgacttcgacaaataccttcagcagag
gacctagagacaaatgaggcactcatccaaggcccagaacacagagatcttggccatggg
aaacctgaagttggtagtgctgcctcctcccagcagcaccagcagatactcctgtgggaa
cagcagcaacggttgttgggtcggcttgccaggggaagtttgggggactcagtgctgttg
ccctctacccagagtggacatcggcccctgtccagggctcagtcctccccagctgctccc
atctccctgccaacttcagaaccacctaaccagaccttagtactatcttgccctgaaact
cctgccaggaccctaccctatacaactgggttggtctatgattcagtgatgctcaaacac
cagtgctcctgtggggacaacagcaatcatcctgagcatgcaggccgaatccaaagtatc
tggtcacggctacaggaacgggggctacggagccagtgtgagtgtctccgaggcaggaag
gcctcattggaggagctacagtcagtccatgatgagagacacgtgctgctttatggcacc
aacccactcagccgactcaaactagacaatggaaagcttgcggggatcctggcacagagg
atgtttgtgatgctgccttgtggtggcgttggggtggacacagatacaatctggaatgaa
ttgcactcctccaatgcagcccgttgggctgctggaagcgtaactgaccttgccttcaag
gtggctgcccgggaactaaagaatggttttgcagtagtgcggcccccaggacaccatgca
gaccattcaactgccatgggtttttgcttcttcaactcggtggctattgcaagtcggcag
ctacagcagcaggggaaggttagcaagatactcatagtagactgggatgttcaccatggc
aatggaactcagcaaaccttctatgaggaccccagtgtgctctacatctctctacatcga
catgatgatggcaatttctttccaggcagtggggctgttgatgaggtgggagctggcaat
ggagaaggcttcaacattaatgttgcttgggctggaggtctcgacccacccatgggagac
cctgaatacctggcagccttcagaacagttgtgatgcccatcgcccaagaattctctcct
gacctggtcatggtgtcggctgggtttgatgctgcagatggccaccccccacctctggga
ggataccatgtctctgccaagtgttttgggtacatgacacagcaactgatgagcttggca
ggaggagcagtagttttggccttggagggtggccatgatctcacagccatttgcgatgcc
tctgaagcttgtgtgactgccctgctaggcaacaaggtggatcccctctcggaagagagc
tggaaacagaaacccaacttaaatgccattagatccttggaagctgtgatccgggtgcac
agtaagtactggggttcgatgcagtggttggcctccagtccagattcctgggtcccctca
gtggcaatggctgacacagaagaagtggagacagtgtcagcactggcctccctttcagtg
ggcatcctgactgaaaagaggccgtcagaacagctggtggaggaagaggaggagcctatg
aatctctaa

DBGET integrated database retrieval system