KEGG   Sarcophilus harrisii (Tasmanian devil): 100924490
Entry
100924490         CDS       T02286                                 

Gene name
EPO
Definition
(RefSeq) erythropoietin
  KO
K05437  erythropoietin
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr04060  Cytokine-cytokine receptor interaction
shr04066  HIF-1 signaling pathway
shr04151  PI3K-Akt signaling pathway
shr04630  JAK-STAT signaling pathway
shr04640  Hematopoietic cell lineage
shr05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:shr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100924490 (EPO)
   04066 HIF-1 signaling pathway
    100924490 (EPO)
   04151 PI3K-Akt signaling pathway
    100924490 (EPO)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100924490 (EPO)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100924490 (EPO)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100924490 (EPO)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:shr04052]
    100924490 (EPO)
Cytokines and growth factors [BR:shr04052]
 Cytokines
  CSF and other factors
   100924490 (EPO)
SSDB
Motif
Pfam: EPO_TPO
Other DBs
NCBI-GeneID: 100924490
NCBI-ProteinID: XP_003768892
Ensembl: ENSSHAG00000008258
UniProt: G3W289
LinkDB
Position
4
AA seq 191 aa
MEMGVHEVLVLLQLLLVHLGFPVWGSPQSPFCESHILERYILEAKEAQNATVACLEDCSL
GENITVPDTRVNFHTWKKMEVGQKAGEVWQGLTLLSEAVLKGQALLANSSQTPVALKLFV
DKAVSSLRSLRFLLRGLGTQEEAIFVPNAPTAVPLRTFTVGTMDKLFRIYSNFLRGKLKL
FWREACQSQER
NT seq 576 nt   +upstreamnt  +downstreamnt
atggagatgggggttcatgaagtccttgttctgctgcagctgctgctagttcaccttgga
ttcccggtgtggggttctccacagtcgcccttctgtgaaagccacatcctggagagatac
atcctcgaggccaaagaggcacagaatgctacggtagcctgcttggaagattgcagcctg
ggtgagaacatcacagtccctgataccagagtgaactttcatacctggaagaagatggag
gtggggcagaaggcaggggaagtctggcagggactgactttgctgtctgaagctgtcctg
aaaggccaggccttgctggccaactcttcccagacaccagtagctctaaagctctttgtg
gacaaagctgtcagcagcttgagaagcctcagattcctgcttcgaggactaggaacacag
gaggaagctatctttgttcccaatgccccaacagcagttccgcttcgtaccttcaccgta
gggactatggacaaactttttcgaatctactccaattttctacggggaaagctcaagctg
ttttggagagaagcctgccaaagccaggagaggtga

DBGET integrated database retrieval system