KEGG   Sarcophilus harrisii (Tasmanian devil): 100925062Help
Entry
100925062         CDS       T02286                                 

Gene name
PCSK1
Definition
(RefSeq) neuroendocrine convertase 1
  KO
K01359  proprotein convertase subtilisin/kexin type 1 [EC:3.4.21.93]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Brite
KEGG Orthology (KO) [BR:shr00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:shr01002]
    100925062 (PCSK1)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:shr03110]
    100925062 (PCSK1)
Enzymes [BR:shr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.93  proprotein convertase 1
     100925062 (PCSK1)
Peptidases [BR:shr01002]
 Serine Peptidases
  Family S8: subtilisin family
   100925062 (PCSK1)
Chaperones and folding catalysts [BR:shr03110]
 Intramolecular chaperones
  Subtilisin family
   100925062 (PCSK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_S8 P_proprotein S8_pro-domain Proho_convert OmpA_membrane Peptidase_S8_N HTH_ABP1_N
Motif
Other DBs
NCBI-GeneID: 100925062
NCBI-ProteinID: XP_003759876
Ensembl: ENSSHAG00000002927
UniProt: G3VJH4
LinkDB All DBs
Position
2
AA seq 752 aa AA seqDB search
MDVRYWSLQYIAFALYFCWCAMYSGRAEKQFVNEWAAEIPGGLNSAREIAEELGYDLLGQ
IGSLENHYLFRHKSHPRRSRRSAIHITKRLSDDDRVTWAEQQYGKERNKRSILRDSAEDL
FNDPMWNQQWYLQDTRMTPVLPKLDLHVIPVWQKGITGKGVVITVLDDGLEWNHTDIYAN
YDPEASYDFNDNDRDPFPRYDPTNENKHGTRCAGEIAMQANNQKCGVGVAYNARVGGIRM
LDGIVTDAIEASSIGFNPNHVDIYSASWGPNDDGKTVEGPGRLAQKAFEYGIKQGRQGKG
SIFVWASGNGGRQGDDCDCDGYTDSIYTISISSASQQGLSPWYAEKCSSTLATAYSSGDY
TDQRITSADLHDDCTETHTGTSASAPLAAGIFALALEVNPQLTWRDMQHLVVWTSEYDPL
AINPGWKKNGAGLMVNSRFGFGLLNAKALVDLADPKTWRGVPEKKECIVKDNNFEPKSLK
ADGVVTIEIPTKACEGQENSIKSLEHVQFEATIEYSRRGDLHVTLTSAAGTSTVLLAERE
RDTSPNGFKNWDFMSVHTWGENPVGTWALRITDMSGRMENEGRIVNWKLILHGTSTQPEH
MKQPRVYTSYNAVQNDRRGVEKMDDSIEDEATLESLHESPQPSKSSTTPNISGNDKLMEK
TPSRAMLQLLQNAFSKQGASNQTPKNHPDEKLKIPYEHFYQALEKLNKPSQLRNAENSLY
SDYVDLFYSTKPYKHRDDRLLQALVDILKEGN
NT seq 2259 nt NT seq  +upstreamnt  +downstreamnt
atggatgtgagatattggtctctgcagtatattgcttttgctctctatttctgctggtgt
gcaatgtacagtggtagagcagaaaaacagttcgttaatgaatgggcagcggagatacct
gggggtctaaattcagccagagagatagcagaggagctgggttacgaccttctcggacag
attggatcacttgaaaatcactacttattcaggcataaaagtcacccaagaaggtctaga
agaagtgccattcacatcacgaagagattatctgatgatgaccgagtaacatgggctgag
caacagtatggaaaagagagaaacaaacgttctatcctaagagattcagcagaggatctc
ttcaatgacccaatgtggaatcagcagtggtatttgcaagataccaggatgaccccagtc
ttgcccaagctggacctccatgtgatcccagtttggcaaaaaggaataacagggaaaggg
gtagttatcaccgttctggacgatggcctggagtggaatcacaccgatatttatgcaaac
tatgacccagaggccagttatgactttaatgacaatgaccgtgatccatttcccagatat
gatcctacaaatgaaaacaagcatggaaccaggtgtgctggagaaattgccatgcaagcc
aataatcagaaatgtggtgttggggtggcctacaatgccagagttggaggcattagaatg
ttggatggcattgtaactgatgccatcgaagccagttccattggattcaatcccaatcat
gtggatatttacagcgcaagctggggcccaaatgatgatgggaaaacagttgaaggccct
ggcaggttagcccaaaaagcttttgaatatggcatcaaacagggaagacagggaaaaggc
tccatcttcgtctgggcatctgggaatggtgggcgtcagggggatgactgtgactgtgat
ggttatacagacagcatttacaccatttccatcagcagtgcctcacagcaaggcctctct
ccctggtatgctgaaaagtgttcatctacactggccactgcctacagcagtggggactac
actgaccagagaatcacaagtgctgatctgcatgatgactgcactgagacccatactgga
acgtcagcctctgctcctctggctgctgggatcttcgctcttgcactagaagtaaaccct
cagcttacctggagagatatgcaacatttggttgtatggacctctgaatatgaccctctg
gccatcaatcctggttggaagaagaatggagcaggattgatggtgaatagtcgatttgga
tttgggttacttaatgctaaggccctggtggatttagctgaccccaaaacttggagaggt
gtccccgagaaaaaagaatgcattgtgaaagacaacaactttgaacccaaatccttgaaa
gctgatggagtagttactattgaaatccctacaaaagcctgtgaaggacaagaaaattcc
atcaagtctttggaacatgtgcaatttgaagcaacaattgaatactcacggagaggagac
cttcatgtcacacttacctctgctgctggaaccagtactgtgctattggctgaaagagag
agagatacatcacccaatggttttaagaactgggacttcatgtctgttcacacatgggga
gagaatcctgtaggcacctgggctttacgaattactgatatgtctggaagaatggaaaat
gaaggaagaattgtgaactggaaactgattttacatgggacatccacccagccagaacat
atgaaacagccccgtgtctatacttcttataatgctgtgcaaaatgatagaagaggagtg
gagaagatggatgattctattgaggacgaggctaccctagaaagccttcatgaaagccct
cagccttctaaaagctccaccacccccaacatcagtggcaatgacaaattgatggagaaa
acaccttccagggccatgctccaactcctgcaaaatgctttcagcaaacagggagcctcc
aatcaaacaccaaagaatcatccagatgaaaagctaaagattccatatgaacatttctat
caagctctggaaaagttaaacaaaccatcccaattaagaaacgccgagaatagtctgtat
agtgactatgtggaccttttctacagcacaaaaccttacaagcacagggatgatcgactg
ctgcaggctttggttgacattctgaaggaagggaattga

DBGET integrated database retrieval system