KEGG   Sarcophilus harrisii (Tasmanian devil): 100925116
Entry
100925116         CDS       T02286                                 

Gene name
PDGFRA
Definition
(RefSeq) platelet-derived growth factor receptor alpha isoform X2
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr01521  EGFR tyrosine kinase inhibitor resistance
shr04010  MAPK signaling pathway
shr04014  Ras signaling pathway
shr04015  Rap1 signaling pathway
shr04020  Calcium signaling pathway
shr04072  Phospholipase D signaling pathway
shr04144  Endocytosis
shr04151  PI3K-Akt signaling pathway
shr04510  Focal adhesion
shr04540  Gap junction
shr04630  JAK-STAT signaling pathway
shr04810  Regulation of actin cytoskeleton
shr05163  Human cytomegalovirus infection
shr05200  Pathways in cancer
shr05206  MicroRNAs in cancer
shr05214  Glioma
shr05215  Prostate cancer
shr05218  Melanoma
shr05230  Central carbon metabolism in cancer
shr05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:shr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100925116 (PDGFRA)
   04014 Ras signaling pathway
    100925116 (PDGFRA)
   04015 Rap1 signaling pathway
    100925116 (PDGFRA)
   04630 JAK-STAT signaling pathway
    100925116 (PDGFRA)
   04020 Calcium signaling pathway
    100925116 (PDGFRA)
   04072 Phospholipase D signaling pathway
    100925116 (PDGFRA)
   04151 PI3K-Akt signaling pathway
    100925116 (PDGFRA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100925116 (PDGFRA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100925116 (PDGFRA)
   04540 Gap junction
    100925116 (PDGFRA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100925116 (PDGFRA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100925116 (PDGFRA)
   05206 MicroRNAs in cancer
    100925116 (PDGFRA)
   05230 Central carbon metabolism in cancer
    100925116 (PDGFRA)
   05231 Choline metabolism in cancer
    100925116 (PDGFRA)
  09162 Cancer: specific types
   05214 Glioma
    100925116 (PDGFRA)
   05218 Melanoma
    100925116 (PDGFRA)
   05215 Prostate cancer
    100925116 (PDGFRA)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    100925116 (PDGFRA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100925116 (PDGFRA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:shr01001]
    100925116 (PDGFRA)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:shr04090]
    100925116 (PDGFRA)
Enzymes [BR:shr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100925116 (PDGFRA)
Protein kinases [BR:shr01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   100925116 (PDGFRA)
CD molecules [BR:shr04090]
 Proteins
  100925116 (PDGFRA)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 ig I-set Ig_2 V-set Adeno_E3_CR1
Other DBs
NCBI-GeneID: 100925116
NCBI-ProteinID: XP_003773296
Ensembl: ENSSHAG00000013199
LinkDB
Position
6
AA seq 1086 aa
MGASPWAFLGLGCLLTGPWLTFCQLPLPTVFPNEDEKVVQLHSSFTLRCSGDSEVSWQYP
MKDEEDQKIEVRNEENNSGLFVTVLEVVNASAVHTGLYTCYYNHTQTEETEIEGRDIYIY
VPDPDVPFVPSAMVDHLIFAEEHDSVTIPCRTTDPQAQVILLNSEEKVVHAFYDSRQGFI
GDFAMGQFKCETVIKGKQFQTIPFNIYTITATPELEVEIEAMKTVYKTGETLVVTCAVLH
NEVVDLQWNYPGKVKNKGILKVDEIKVPSLKLVYTLTVPKVTVKDSGDYECAARHATKET
KEIKKVTISVHEKGFIELKPNFSQMETINLHEVRHFVVDVQAYPPPKIFWLKDNMTVIEN
LTEIITGLDKIQEIRYQSKLKLIRAKEEDSGYYTIMAQNEDDIKNYTFELTIQVPASILD
LEDDNHGSAGGQMVKCVAEGTPIPNVEWMICKDITKCNNETSWTLLASNMSDIITQKHDS
SVVKSQVTFDKIEDTMAVRCLAKNSLGTVSRELKLVAPAIRSELTVAASVLVLLVIVIFS
LIILIVIWKQKPRYEIRWRVIESISPDGHEYIYVDPMQLPYDSRWEFPRDGLVLGRILGS
GAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSELKIMTHLGPHLNIVNLL
GACTKSGPIYIITEYCFYGDLVNYLHKNRDNFLSHHPEKAKKELDIFGMNSADESTRSYV
ILSFENNGDYMDMKQADTTQYVPMLERKQGSKYSDIQRSMYDRPASYKKKSVSDPEVKNL
LSDDGSEGLSLLDLLSFTYQVARGMEFLASKNCVHRDLAARNVLLAQGKIVKICDFGLAR
DIMHDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGILLWEIFSLGGTPYPGMMV
DSTFYNKIKSGYRMAKPDHATSEVYEIMVKCWNSEPEKRPSFYHLSEIVENLLPGQYKKS
YEKIHLDFLKSDHPAVARMRVECDNTYIGVTYKNEDKMKDWEGSYDEQRLSADSGYIIPL
PDIDPIPEDDLGKRNRHSSQTSEESAIETGSSSSTFIKREDETIEDIDMMDDIGIDSSDL
VEDSFL
NT seq 3261 nt   +upstreamnt  +downstreamnt
atgggtgcttccccatgggcgttcctgggcttgggatgtctcctcacagggccgtggctc
acattttgccagcttccattacccactgtctttccgaatgaggatgaaaaggttgtgcag
ctgcattcatcttttaccctaagatgctctggggacagtgaagtgagctggcagtacccc
atgaaggatgaagaggaccaaaaaatagaagtcagaaacgaggagaacaacagtggcctt
tttgtgacggtcctggaagtggtcaatgcctcagctgtacacacaggactgtacacttgt
tattacaaccacactcagacagaggagactgagatcgaaggcagagacatctacatctat
gtgccagatccagatgttcctttcgtaccttcagccatggttgatcatttaatttttgcg
gaggaacatgattctgtcactattccatgtcgcacaactgatcctcaagctcaagtgatt
ctactcaacagtgaagaaaaagtggtccatgctttctatgatagcagacaaggttttatt
ggagactttgccatgggacaattcaaatgtgaaacagttatcaaagggaaacaattccaa
acaattcctttcaacatttatacgataacggctactccagagcttgaagttgagatagag
gcaatgaaaactgtttacaaaacaggagagactcttgttgtaacttgtgctgtcttgcac
aatgaagtggttgaccttcagtggaattatccaggaaaagtgaaaaacaaaggcattttg
aaagttgatgagatcaaagttccatctctcaagttggtgtacacgctgacggtccctaag
gtgacagtgaaagatagtggagactatgaatgtgctgcccgtcatgctaccaaggaaact
aaggaaattaagaaagtcaccatttctgttcatgagaagggatttattgagctcaaaccc
aacttcagtcagatggaaaccattaacttgcatgaagtccgccattttgtagtggatgtg
caagcgtatccaccaccaaagatattctggcttaaggacaatatgaccgtaattgagaat
ctgaccgaaatcatcactggcttagataagatccaggaaataagatatcaaagcaaatta
aaactgattcgtgctaaggaagaagatagtggatattatacaattatggctcaaaatgag
gatgatattaagaactatacttttgaacttacaattcaggttcctgcttctattctggac
ctggaggatgacaaccatggctctgcaggtggtcagatggtcaaatgtgtagcagaaggg
actccaattccaaatgtggaatggatgatttgcaaggatattacaaagtgtaataatgaa
acttcatggacactcttggccagcaacatgtccgatataatcacacagaaacacgatagt
agcgtggtgaagagccaagtgaccttcgacaaaattgaagacaccatggccgtacgatgc
ctagcgaagaactcgcttgggacagtgagccgggaactgaagctcgtggctcctgctatt
cgttcagaattgacagtggctgcctcggtccttgtgttactagtgattgtcatcttttcc
ctcattatcctgattgtcatatggaaacagaaaccgaggtatgaaattcgatggagagtt
attgagtccattagccctgatggccacgagtacatttatgtggatccaatgcaactgcct
tatgattcaagatgggagtttcctagagatgggctagtccttggccgaatcctgggctca
ggtgcgtttggaaaagtggtcgaagggactgcatacggattaagccgttcccagcctgtg
atgaaggtggccgtgaaaatgctaaaacccacagccagatccagtgaaaaacaggccctc
atgtcagaactcaagattatgactcacctgggacctcatttaaatattgtaaatcttcta
ggagcctgtaccaagtcaggtcccatttatatcatcactgaatattgcttctatggggat
ttggtcaactatctgcataagaacagagacaatttcctgagccaccatccagagaaggca
aagaaagagctagatatctttgggatgaattcagctgatgaaagcacaaggagctatgtc
attttatccttcgaaaacaatggggattatatggacatgaagcaagccgataccacacag
tatgttcccatgctggaaaggaaacagggctcgaaatattcagatattcaaagatcgatg
tatgaccgaccagcatcatacaaaaagaaatctgtgtcagatccagaagtcaaaaacctc
ctttcagatgacggctccgaaggtctcagtctcttggatctgttgagcttcacttaccaa
gttgcccgaggaatggagtttttggcttcaaaaaattgtgttcaccgtgacctggctgct
cgcaatgtgcttctggctcaaggaaaaatcgtgaagatctgtgactttggcctggccaga
gacatcatgcatgattccaactatgtgtccaagggcagtacttttctgccagtgaagtgg
atggctcctgaaagtatctttgacaatctgtataccacgctgagcgacgtctggtcttat
ggcatcctgctgtgggagattttttctcttggaggcacaccctatcctggaatgatggtg
gattctactttctataataaaatcaaaagtggataccgcatggccaaacccgaccacgcc
accagtgaagtttacgagatcatggtgaagtgctggaatagtgagcccgagaagagacct
tccttctaccacctgagtgagattgtggaaaacctgcttcctggccagtataagaagagt
tatgagaaaatccacctggacttcctgaagagtgaccatcctgctgttgctcgcatgaga
gtggagtgtgacaatacttacattggtgtcacctacaaaaatgaggataagatgaaggac
tgggaaggcagctatgatgaacaacggttgagtgctgacagtggctatatcatccctctg
cctgatattgaccctatcccagaagatgacctaggcaagagaaacagacacagttcccag
acatctgaggaaagtgccattgagacaggttccagcagttccaccttcatcaagagagag
gatgaaaccattgaggacatcgacatgatggatgacattgggatagactcctcagacttg
gttgaagacagcttcctgtaa

DBGET integrated database retrieval system