KEGG   Sarcophilus harrisii (Tasmanian devil): 100925657
Entry
100925657         CDS       T02286                                 

Gene name
ADCY3
Definition
(RefSeq) adenylate cyclase type 3
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr00230  Purine metabolism
shr01100  Metabolic pathways
shr01522  Endocrine resistance
shr04015  Rap1 signaling pathway
shr04020  Calcium signaling pathway
shr04022  cGMP-PKG signaling pathway
shr04024  cAMP signaling pathway
shr04062  Chemokine signaling pathway
shr04072  Phospholipase D signaling pathway
shr04114  Oocyte meiosis
shr04211  Longevity regulating pathway
shr04213  Longevity regulating pathway - multiple species
shr04261  Adrenergic signaling in cardiomyocytes
shr04270  Vascular smooth muscle contraction
shr04371  Apelin signaling pathway
shr04540  Gap junction
shr04611  Platelet activation
shr04713  Circadian entrainment
shr04714  Thermogenesis
shr04723  Retrograde endocannabinoid signaling
shr04724  Glutamatergic synapse
shr04725  Cholinergic synapse
shr04727  GABAergic synapse
shr04740  Olfactory transduction
shr04750  Inflammatory mediator regulation of TRP channels
shr04911  Insulin secretion
shr04912  GnRH signaling pathway
shr04913  Ovarian steroidogenesis
shr04914  Progesterone-mediated oocyte maturation
shr04915  Estrogen signaling pathway
shr04916  Melanogenesis
shr04918  Thyroid hormone synthesis
shr04921  Oxytocin signaling pathway
shr04923  Regulation of lipolysis in adipocytes
shr04925  Aldosterone synthesis and secretion
shr04926  Relaxin signaling pathway
shr04927  Cortisol synthesis and secretion
shr04928  Parathyroid hormone synthesis, secretion and action
shr04934  Cushing syndrome
shr04935  Growth hormone synthesis, secretion and action
shr04962  Vasopressin-regulated water reabsorption
shr04970  Salivary secretion
shr04971  Gastric acid secretion
shr04972  Pancreatic secretion
shr04976  Bile secretion
shr05032  Morphine addiction
shr05163  Human cytomegalovirus infection
shr05166  Human T-cell leukemia virus 1 infection
shr05200  Pathways in cancer
shr05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:shr00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100925657 (ADCY3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100925657 (ADCY3)
   04371 Apelin signaling pathway
    100925657 (ADCY3)
   04020 Calcium signaling pathway
    100925657 (ADCY3)
   04072 Phospholipase D signaling pathway
    100925657 (ADCY3)
   04024 cAMP signaling pathway
    100925657 (ADCY3)
   04022 cGMP-PKG signaling pathway
    100925657 (ADCY3)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100925657 (ADCY3)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100925657 (ADCY3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100925657 (ADCY3)
   04062 Chemokine signaling pathway
    100925657 (ADCY3)
  09152 Endocrine system
   04911 Insulin secretion
    100925657 (ADCY3)
   04923 Regulation of lipolysis in adipocytes
    100925657 (ADCY3)
   04912 GnRH signaling pathway
    100925657 (ADCY3)
   04913 Ovarian steroidogenesis
    100925657 (ADCY3)
   04915 Estrogen signaling pathway
    100925657 (ADCY3)
   04914 Progesterone-mediated oocyte maturation
    100925657 (ADCY3)
   04921 Oxytocin signaling pathway
    100925657 (ADCY3)
   04926 Relaxin signaling pathway
    100925657 (ADCY3)
   04935 Growth hormone synthesis, secretion and action
    100925657 (ADCY3)
   04918 Thyroid hormone synthesis
    100925657 (ADCY3)
   04928 Parathyroid hormone synthesis, secretion and action
    100925657 (ADCY3)
   04916 Melanogenesis
    100925657 (ADCY3)
   04925 Aldosterone synthesis and secretion
    100925657 (ADCY3)
   04927 Cortisol synthesis and secretion
    100925657 (ADCY3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100925657 (ADCY3)
   04270 Vascular smooth muscle contraction
    100925657 (ADCY3)
  09154 Digestive system
   04970 Salivary secretion
    100925657 (ADCY3)
   04971 Gastric acid secretion
    100925657 (ADCY3)
   04972 Pancreatic secretion
    100925657 (ADCY3)
   04976 Bile secretion
    100925657 (ADCY3)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    100925657 (ADCY3)
  09156 Nervous system
   04724 Glutamatergic synapse
    100925657 (ADCY3)
   04727 GABAergic synapse
    100925657 (ADCY3)
   04725 Cholinergic synapse
    100925657 (ADCY3)
   04723 Retrograde endocannabinoid signaling
    100925657 (ADCY3)
  09157 Sensory system
   04740 Olfactory transduction
    100925657 (ADCY3)
   04750 Inflammatory mediator regulation of TRP channels
    100925657 (ADCY3)
  09149 Aging
   04211 Longevity regulating pathway
    100925657 (ADCY3)
   04213 Longevity regulating pathway - multiple species
    100925657 (ADCY3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100925657 (ADCY3)
   04714 Thermogenesis
    100925657 (ADCY3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100925657 (ADCY3)
  09165 Substance dependence
   05032 Morphine addiction
    100925657 (ADCY3)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    100925657 (ADCY3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100925657 (ADCY3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100925657 (ADCY3)
   05163 Human cytomegalovirus infection
    100925657 (ADCY3)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100925657 (ADCY3)
Enzymes [BR:shr01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     100925657 (ADCY3)
SSDB
Motif
Pfam: Guanylate_cyc AC_N HNOBA Peptidase_S49_N
Other DBs
NCBI-GeneID: 100925657
NCBI-ProteinID: XP_031807309
Ensembl: ENSSHAG00000006048
LinkDB
Position
2
AA seq 1145 aa
MAKNQGFSEPEYSAEQSAEYSVSLPSDPDRAGGRTHEISVRNTGSCLCLPRFMRLTFIPE
SLENLYQTYFKRQRHETLLVLVIFAALFDCYVVIMCAVVYSSDKLAPIVVAGVGLLLDII
LFVLCKKGLLPDRVSRKVVPYLLWLLITAQIFSYLGLNFARSHAASDTVGWQAFFVFSFF
ITLPLNLTPIVLISVVSCCIHTLVLGVTVAQQQQEQLDGIGLLREILANVIIYLCSIIVG
IMSYYMADRKHRKAFLEARQSLEVKINLEEQSQQQENLMLSILPKHVADEMLKDMKKDES
QKDQQQFNTMYMYRHENVSILFADIVGFTQLSSACSAQELVKLLNELFARFDKLAAKYHQ
LRIKILGDCYYCICGLPDYREDHAVCSILMGLAMVDAISYVREKTKTGVDMRVGVHTGTV
LGGVLGQKRWQYDVWSTDVTVANKMEAGGIPGRVHISQSTMDCLKGEFEVEPGDGGSRCD
YLDEKGIVTYLICSPKPVSPDQQQTPNGINGTATKVGLSQPSSPILINTKEPKEPNGNVT
ASSPSPEETEDLDTQVVNPSFPNPRRRLRLHDLAERVVDASEDEHELNQLLNEALLERES
AQVVKKRNTFLLSMRFMDPEMETRYSVEKEKQSGAAFSCSCVVLLCTSLVVILIDPWLMT
NYMTFVVGEVLLLILTISSMAAIFPRRFPKKLVAFSTWIDRTRWARNTWAMSAIFILILA
NVVDMLSCLQNYTGITNGTTVTIMAGGCVDNPKYYSYVAVLALIAAIMLVQVSHMVKLTL
MLLVTAAVGVINIYAWRPIFDAYDRKRFQEHDSSPLVITEKMQVFTTINGTDGLPLIPSK
YSMTVMVFMMMLSFYYFARHVEKLARTLFLWKIEVHDQKERVYEMRRWNEALVTNMLPEH
VARHFLGSKKRDEELYSQSYDEIGVMFASLPNFADFYTEESINNGGIECLRFLNEIISDF
DSLLDNPKFRIITKIKTIGSTYMAASGVTPDVNTNGFTSGNKEEKSDKERWQHLADLADF
ALAMKDTLTNINNQSFNNFMLRIGMNKGGVLAGVIGARKPHYDIWGNTVNVASRMESTGV
MGNIQVVEETQTILREYGFRFVRRGPIFVKGKGELLTFFLKGRDKPAPFPNGSSVTLPHQ
VVDNS
NT seq 3438 nt   +upstreamnt  +downstreamnt
atggccaagaaccagggcttctcggagcccgagtactcggccgaacagtcggcagagtac
tcggtcagtttgccttcagatcccgatcgggcaggtggccggacccatgaaatctctgtc
aggaacacggggtcctgcctctgcctgccccgcttcatgcgcttgactttcatcccggag
tctctggagaatctgtaccagacttatttcaagaggcagcgccatgagaccctcctggtc
ctggtgatctttgctgccctcttcgattgctatgtggtgatcatgtgtgccgtggtctat
tccagtgacaagctggctcccattgtggtggccggggtggggctgctgctggacatcatc
ctctttgtcctctgtaagaagggccttctcccagacagagtcagcaggaaggtggtcccc
tatctgctctggctgctgatcaccgcccagatcttctcttacctcggtttgaactttgct
cgctcccatgcggccagtgacacggtgggctggcaggccttcttcgtcttctccttcttc
atcacactgcctctcaatctcactcccattgtgctcatctcagtggtctcctgctgcatc
catactctggtgctgggggtaactgtggcccagcagcagcaggagcagttggatggcatt
gggttactaagggagatcctggccaatgttatcatctacctgtgctccatcatcgtgggc
attatgtcctactacatggctgaccgcaagcataggaaggccttcctcgaagcccgccag
tcccttgaagtgaagatcaacttggaggagcagagccagcagcaggaaaaccttatgctt
tctatcttacccaagcatgtcgctgatgagatgttaaaggacatgaagaaagatgagagc
cagaaagaccagcagcagttcaatactatgtacatgtaccgccatgagaatgtcagcatt
ctgtttgctgacatcgtgggtttcactcagctatcttcagcctgtagtgcccaggagttg
gtgaagctgctcaatgaactcttcgcccgctttgacaagctggcagctaaatatcatcag
ttgcgtatcaagattctgggagattgttattactgcatctgtggattgcctgactaccgg
gaggatcatgccgtctgttccatcctcatggggctcgccatggtggatgccatttcgtat
gtgcgggagaagacaaagacgggggtggacatgcgtgtcggcgtccacacgggtaccgtg
ctggggggagtgctgggccagaagcgatggcagtatgatgtgtggtccacagacgtcact
gttgccaataagatggaagccggcggcatccccggacgtgtgcacatctcacagagcacc
atggactgcttgaagggtgagtttgaagtggagccaggtgatggaggcagccgctgtgac
tacctagacgaaaaaggcattgtcacctacctcatttgttcccctaaacctgtgtctcca
gatcagcagcaaacccctaatggtatcaatggcacagccacgaaggtggggctctcgcag
cccagctcccccatcctgatcaacactaaggagcccaaggagcccaatgggaacgtcacc
gcctcctccccgagtccggaggaaacggaggacctggacacgcaggtggtcaatccctca
ttccccaaccctcgccggcgtttgcgccttcacgatttggcggagagagttgtggatgcc
tctgaggatgaacacgagctcaatcagctgctcaacgaggctctgctggagagggagtca
gctcaggtggtaaagaaaagaaacaccttccttctctccatgaggtttatggaccctgag
atggagacgcgctactcggtggagaaggagaagcagagtggggctgccttcagttgctcc
tgtgttgtgctcctttgcacgtccttggtggtgattcttattgatccctggctaatgaca
aattacatgacctttgtggttggagaggttctgttgctgattctgacaatcagctcgatg
gctgccatcttcccccggcggttcccaaagaagctcgtggccttttctacctggattgac
cggacccgttgggctaggaatacttgggccatgtccgccattttcattctcatcttggcc
aatgttgtggatatgctcagctgcttgcagaactacacgggaatcaccaacggaacaacg
gtgaccatcatggcagggggctgcgtcgacaatcccaaatactacagctacgtggccgtg
ctggcgctcattgccgccatcatgctggtgcaggtcagccatatggtgaagctcacgctc
atgctactggtcacggcagccgtgggggtcatcaacatctacgcctggcgccccatcttc
gatgcatatgaccgaaaacgcttccaggagcatgactcctcacccctggtcattacagag
aagatgcaggtgtttaccaccatcaatggcactgatgggctgcctttgatcccctccaag
tactccatgacggtgatggtcttcatgatgatgctaagtttttactactttgcccggcac
gtggaaaaactggcccgcaccctgttcctgtggaagatcgaagtccatgaccagaaggaa
cgtgtgtacgaaatgagacgctggaatgaggccctggtcaccaacatgctgccggagcac
gtggcccgccatttcttgggctcaaagaaacgggatgaggaactgtacagtcagtcatat
gatgagattggcgtcatgtttgcctccctgcccaactttgctgacttctacacggaggag
agcatcaacaatgggggcattgagtgcctccgcttccttaacgagatcatctcggacttt
gactctctcctggacaaccctaaatttcgtatcatcaccaagatcaagaccattggcagc
acctatatggcagcatcgggggtcacaccagatgtcaacaccaatggctttacaagtgga
aacaaggaggaaaagtcagataaagaacgctggcagcatcttgcagatctggctgacttc
gctctggccatgaaggacactcttactaacatcaacaatcagtctttcaacaatttcatg
cttcgcataggtatgaacaaaggaggagtactggccggagttataggggcccgaaaaccc
cattatgacatctgggggaataccgtcaatgtggccagtagaatggagtcaacaggtgtc
atgggcaatatccaggtggtagaggaaacacagaccatcctacgggaatatggcttccgc
tttgtcagacgtggccccatctttgtcaaaggaaagggggagctgctgaccttcttcctt
aagggacgggataagccggccccattccctaatggctcctccgtcacgctgccccaccag
gtagtggacaactcctga

DBGET integrated database retrieval system